KEGG   Mus musculus (house mouse): 71096
Entry
71096             CDS       T01002                                 
Symbol
Sntg1, 4933426D16Rik, G1SYN, SYN4
Name
(RefSeq) syntrophin, gamma 1
  KO
K24065  gamma-syntrophin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    71096 (Sntg1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   71096 (Sntg1)
SSDB
Motif
Pfam: PDZ PH PDZ_6 Tricorn_PDZ PDZ_2
Other DBs
NCBI-GeneID: 71096
NCBI-ProteinID: NP_001277322
MGI: 1918346
Ensembl: ENSMUSG00000025909
UniProt: Q925E1 Q8BNW6 Q8C415 Q8CAI8
Position
1:complement(8429963..9371882)
AA seq 517 aa
MDFRTTCEETKTGVCLLQDGNQEPFKVRLHLARDLLMLQEQDVLCVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVISKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHARFSQYVPGTDLSRQNAFQVVAVDGVC
SGILQCLSAEDCMDWLQAIASNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQESLQD
RVYTPVFLALRGSCLYRFLSPPVTTWDWTRAEKTFSVCEIMCKVLKDSDLLDRRKHCFTM
QSECGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGNQAATTAAVSSASTSKAKHLA
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggatttcagaactacctgtgaggagacgaagacaggtgtttgcttgctacaagatggt
aatcaagaaccttttaaagtccggttacaccttgccagagacctgttgatgctacaggag
caggatgtgctgtgtgtgtctggtgagcctttctattctggtgaaagaacggtgaccatc
agaagacagacagtaggaggattcggattaagcataaagggaggtgcagaacataacatc
ccggttgtcatttccaaaatatctaaggagcaaagagcagagctgtcggggctgcttttt
attggagatgcaattctacagataaatggaattaatgtgaggaaatgcagacatgaggag
gtggttcaggttcttcggaatgctggggaggaagtgaccctgacagtgtcattcttaaaa
cgagcacctgctttcctcaaactcccagttaatgaagactgtgcatgtgctccaagtgac
caaagcagtggtacctcctctcctctttgtgacagtggcttacacctcaactaccatcca
aataacacagacacgctttcctgctcttcgtggcccacatctccaggcctgaggtgggag
aagcggtggtgtgacctcaggctcattcccctacttcatgcccgcttctctcagtatgtg
cccgggactgacctgagtcggcagaacgctttccaagttgttgctgtggatggagtctgc
agtggaattcttcagtgcctctctgctgaagactgcatggattggctccaagcaatagca
tctaacatttcaaacctcacaaagcacaatatcaaaaaaatcaacagaaatttccctgta
aaccagcagatagtctacatgggctggtgtgaagcccgggagcaggaatccctccaagac
cgtgtgtatacacctgtgtttcttgccctgaggggctcctgtctttacaggttcctgtca
cctccagtgaccacctgggactggactcgagcagagaaaaccttctccgtgtgtgagatc
atgtgcaaggttctcaaggacagtgacctgctggatcggcggaaacattgcttcactatg
cagtctgagtgtggggaggacctctacttctctgtggagctagagagtgaccttgcccaa
tgggaacgagccttccaaacagccacctttcttgaagtggagcgcatacagtgcaagacc
tatgcatgtgtgttggagagtcacttaatgggcctcactattgacttcagcacaggcttc
atctgctttgacgcagcaacaaaggctgtactttggaggtataaattttctcagcttaaa
ggctcatcagatgacggcaaaagcaaaatcaaatttctgtttcagaatccagatacgaaa
cagattgaagcaaaggagttggaattttcaaatttatttgctgttcttcactgtattcat
tcattttttgctgccaaagtagcttgtttggaccctctgtttttaggtaatcaggctgcc
actactgctgctgtcagctctgcttctacaagcaaggcaaagcacctggcttga

DBGET integrated database retrieval system