KEGG   Mus musculus (mouse): 71101
Entry
71101             CDS       T01002                                 

Gene name
Uvssa, 4933407H18Rik, D330017J19Rik, Kiaa1530, mKIAA1530
Definition
(RefSeq) UV stimulated scaffold protein A
  KO
K23720  UV-stimulated scaffold protein A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    71101 (Uvssa)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      71101 (Uvssa)
SSDB
Motif
Pfam: DUF2043 Topoisom_I_N
Other DBs
NCBI-GeneID: 71101
NCBI-ProteinID: NP_001074570
MGI: 1918351
Ensembl: ENSMUSG00000037355
Vega: OTTMUSG00000028632
UniProt: Q9D479
Position
5; 5 B1
AA seq 717 aa
MDQKLSQLIEELTTSGESQLNAQKMKELKKICKSSEEQLSHAYRLLITQLTQGHAEIRLS
AFQIVDELFTRSHQFRMLLVSDFQEFLELTLGTDSDRPLPPPREAAQRLRQAAMQAVEGW
NEKFGQAYKKLALGYHFLKHTKKVDFRDINVRTVAERKREEEKQKHLDKIHRESADRAKR
EMEEMYDEIECCLTEVENCFKLLVPLDFVPCPEDKFFGEASSMTEGYAPCPLSPDLATPR
ESGLSGPQDEEQPCCSKDLVASAYHVGSVVGLKALPQTAMKDSSRDEDEPSDPDDFLRSH
GLGSHKYTLDVEVPSDGLKVQENEDNLAVLHAARDSLKLIQNKFLPTVCSWVQRFTRAGT
YSAHLKQAIDLKMELELALKKYEELNIEPGRGQRSRTEALEDSEDEDQDFVEVPEKEGYE
PRIPDHLRAEYGLEPKAPLKTLEKGTAVCKLQERTRMRREEEASDPTSAAAQMLRLQDCL
SSPSPSSTRVLPGPEEAQKQAERARAPIVPFGVDLCYWGQEQLTAGKILKSDSQHRFWKP
SEVEEEVDSAHVSEMLHSRHITFSGTFEPVQHKCRALRPNGRLCERQDRLKCPFHGKIIP
RDDKGQPLNPEDRAREQRQQLQRQQAHPDWQDPEFLKDVEAATGVDLGSSRSSKKGKGKK
KKHPNLTDLRERTNTARARLEKKVFAKAAVQRVVAAMNQMDQKKHEKFANQFNYALK
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggatcagaaactttcacagttgatagaggagctcacaacttcaggagaatcccaactc
aatgctcagaaaatgaaggaactgaagaaaatttgcaagtcttccgaggagcagctgagc
catgcctaccgcctgctgatcacacagctgacccagggccatgccgagatccgcctctcg
gccttccagatcgtggatgagctcttcacccgctctcatcagttcagaatgctgcttgtt
tctgacttccaggaattcctcgagctcacactgggcacagatagtgaccgtcccctgcca
ccccctcgggaggcagctcagaggctaaggcaggcagccatgcaagctgtggaaggttgg
aatgagaagtttgggcaggcctataagaagctagccttgggctaccacttcctaaaacac
accaaaaaggtagattttcgggatataaatgttaggactgtggcagaaaggaagcgagaa
gaggagaagcagaagcacctggataaaatccacagagaaagtgcagaccgggctaagagg
gaaatggaagaaatgtatgatgaaattgaatgctgcctgacagaagtggagaactgcttt
aagctgctggtgcccttggattttgtaccatgcccagaggataaattctttggtgaagcg
tctagcatgacagagggctatgctccttgccccttgagcccggacctggccactccccgt
gagtctggtctctctggaccccaggatgaagagcagccatgctgtagcaaggacctggtt
gcctctgcataccatgtaggatctgttgttggtctgaaggcactaccccaaacagccatg
aaagactcctccagggatgaggacgaacccagcgacccggatgatttcctgcggagccat
ggactgggttcccacaagtacacgctggatgttgaagtcccctcagatggtctgaaggtt
caggagaatgaagacaaccttgctgtgctccatgctgctcgggactcgctcaaactcatc
cagaacaagtttctgccaactgtgtgctcctgggtccagcggtttacccgtgcagggacc
tacagtgcacatttaaaacaggccattgacctgaaaatggaactggaacttgccctgaag
aagtatgaagaactgaacattgagcctgggagaggacagaggagcaggacagaagcactg
gaggacagtgaggatgaggatcaggactttgtggaggtcccagagaaagagggttatgag
cctcgaatccctgaccatctacgagctgaatatgggctggagccaaaggccccactgaag
actctggagaaaggtacagctgtatgtaagttacaggagaggaccaggatgagaagagaa
gaggaggcctcagaccccacctctgcagctgcccagatgttgcggctccaggactgctta
tcatctccctctccctcctctaccagggtacttcctgggccagaggaagcccagaagcaa
gcagagcgagcccgagcacccattgtacccttcggagtggacctgtgttactggggccag
gagcagctaacagctggaaagattcttaaatctgactctcaacaccgcttctggaaaccc
agcgaggtggaggaagaggtggacagtgcccatgtttctgagatgctccatagccgacac
attaccttttcagggacgtttgagcctgtgcagcacaagtgccgggccctgaggcctaat
ggcaggctctgcgagcgccaggatcgactgaagtgcccattccatgggaagatcatcccc
agagatgacaaggggcagcctctcaacccagaagacagagcccgtgaacaaaggcagcag
cttcagcggcagcaggcacatccagattggcaggaccctgagtttctgaaggacgtggaa
gcagccacaggggtggacctcggttcatccaggtccagcaagaaaggcaaagggaaaaag
aagaagcaccctaacctcacggatctgcgagagcgcaccaacaccgcccgggcccgcctt
gagaagaaggtctttgccaaggcagccgtgcagagagtagttgctgccatgaaccagatg
gaccagaagaaacacgagaagtttgcaaaccaatttaattatgcgctgaagtaa

DBGET integrated database retrieval system