KEGG   Mus musculus (mouse): 71137
Entry
71137             CDS       T01002                                 

Gene name
Rfx4, 4933412G19Rik, NYD-sp10
Definition
(RefSeq) regulatory factor X, 4 (influences HLA class II expression)
  KO
K09174  regulatory factor X 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    71137 (Rfx4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other basic domains
   RF-X
    71137 (Rfx4)
SSDB
Motif
Pfam: RFX_DNA_binding Pox_D5 FANCL_d1
Other DBs
NCBI-GeneID: 71137
NCBI-ProteinID: NP_001020089
MGI: 1918387
Ensembl: ENSMUSG00000020037
Vega: OTTMUSG00000037132
UniProt: Q7TNK1
Position
10; 10 C1
AA seq 735 aa
MHCGLLEEPDMDSTESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPA
TLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLG
TRGQSKYHYYGIAVKESSQYYDVMYSKKGAAWVSETGKREVTKQTVAYSPRSKLGTLLPD
FPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHML
PVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHD
LPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLSSITK
QTLYTMEDSRDEHRRLIIQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSL
KKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANEL
MRAMKGEGSTAEAQEEIILTEATPPTPSPGPSFSPAKSATSVEVPPPSSPVSNPSPEYTG
LSTAGAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRSTHMPSSSVTHRIPVYSHREEHGY
TGSYNYGSYGNQHPHPLQNQYPALPHDTAISGPLHYSPYHRSSAQYPFNSPTSRMEPCLM
SSTPRLHPTPVTPRWPEVPTANACYTSPSVHSTRYGNSSDMYTPLTTRRNSEYEHMQHFP
GFAYINGEASTGWAK
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgcattgtgggttactggaggaacccgacatggattccacagagagctggattgaaaga
tgtctcaatgaaagcgagaataaacgctattccagtcacacatctctggggaatgtgtct
aatgatgaaaatgaggaaaaagaaaataacagagcatccaagccccactccacgccggcc
accctgcaatggctggaggaaaactatgagattgctgagggcgtctgcatcccccgcagc
gccctctacatgcactacctggatttctgtgagaagaacgacactcagcctgtcaatgct
gccagctttgggaagatcataaggcagcagtttcctcagctaaccaccagaagactcggg
acccgaggacagtcaaagtaccattactatggcatagcggtgaaggagagctcccagtat
tatgatgtgatgtactcaaagaaaggagctgcctgggtgagcgagacgggcaagagagaa
gtcaccaagcagacggtggcatattctccccggtccaagcttgggacattgctgccagac
tttccaaacgtcaaagacctaaatctgccagccagtcttcctgaggagaaggtgtctacc
tttattatgatgtacagaacacactgtcagagaatactggacactgtaataagagccaac
tttgatgaggttcaaagtttccttctgcacttttggcaagggatgccgccccacatgctg
cccgtgctaggctcctccacggtggtgaacatcgtgggtgtgtgtgactccatcctctac
aaagccatctccggtgtgttgatgcccacggtgctgcaggcgttgccggacagcttaact
caggtgatccgaaagtttgccaagcagctggacgagtggctgaaagtggctctccacgat
ctcccggaaaacctgagaaacatcaaatttgaattatcaaggaggttttcccaaatccta
aggaggcaaacatcgctgaaccatctgtgccaggcatctcgaacggtgatccacagtgca
gacatcacgttccagatgctggaggactggaggaatgtggacctgagtagcatcaccaag
cagactctgtataccatggaggactctcgggatgagcaccgcagactcatcatccagttg
taccaggagtttgaccacctgctggaggaacagtcccccatcgagtcttacatagaatgg
ctggataccatggtagaccgatgcgttgtaaaggtggctgccaagagacaagggtctctg
aagaaagtagcccaacagttcctgctgatgtggtcttgctttggtacgagggtgatccgg
gacatgaccttgcacagtgcccccagcttcgggtcttttcacctgattcacctgatgttc
gacgactacgtgctctacttgctagaatctctgcattgtcaggagcgggccaacgagctc
atgcgagccatgaaaggagaaggaagcactgcagaagcccaggaagagattatcttgaca
gaggctaccccaccaaccccttcacctggtccatcattttctccagcaaagtctgccaca
tctgtggaggtgccacctccctcctcccctgtcagcaacccatcccccgaatacactggc
cttagcacagcaggagcgatgcagtcatatacgtggtcgctaacatatacagtaacaacg
gctgcagggtcaccggctgagaactcccaacaactaccctgtatgaggagcacccatatg
ccttcttcctccgtcacacacaggataccagtctactcccacagagaggagcatgggtac
acgggaagctataactacgggagctatggcaaccagcatcctcacccactgcagaaccag
tatccagccttgcctcatgacacagccatctctgggcctctccactattccccttaccac
aggagctctgcccagtaccctttcaatagccccacttccaggatggaaccttgtttgatg
agcagtactcccaggctgcatcctaccccagtgactccccgatggccagaggtgccgact
gccaacgcatgctacacaagcccatctgtgcattccacgaggtatggaaactctagtgac
atgtacaccccgctgaccacgcgcaggaattctgagtatgagcacatgcaacactttcct
ggctttgcttacatcaacggagaggcctccactggatgggctaagtga

DBGET integrated database retrieval system