KEGG   Mus musculus (mouse): 71138
Entry
71138             CDS       T01002                                 

Gene name
Tmem217, 4933413N12Rik, EG622644
Definition
(RefSeq) transmembrane protein 217
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4534
Other DBs
NCBI-GeneID: 71138
NCBI-ProteinID: NP_001156373
MGI: 3646280
Ensembl: ENSMUSG00000079580 ENSMUSG00000091614
UniProt: Q14AF1
Position
17; 17 A3.3
AA seq 189 aa
MKHHSWCGLTARMGTVLSGVFSIMATHMHLIFERKHLGNGNCTENFQAQGLNILRYFFIC
WSFQIVLFTSIITMIASCFLLYSVYAQIYEGLMSYVIWIIIYESTSLTVQTLTDEFSVAL
VRAMRWFGWVSRASLHCFWLYFVVTHAQIIYQSKKQGNILTYHRRISLGSGDRPRRKSKI
IHFVQHHSE
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaagcatcacagctggtgtgggttgacagccaggatgggcacagtgttgtcaggggtc
ttctccatcatggctacccacatgcacctcatctttgaaaggaaacatcttgggaacggc
aactgcacggagaacttccaggctcagggcctcaacatactgaggtacttcttcatctgc
tggagcttccaaatcgtcctcttcacgtccatcatcaccatgatagccagctgcttcctc
ctgtactctgtgtatgcccagatatacgagggcctcatgagctacgtcatctggatcatc
atctatgagtccaccagcctgaccgtccagaccctcaccgacgagttcagtgtggccctg
gtcagagccatgcgatggttcggctgggtgtcccgtgcctccctacactgcttctggcta
tattttgttgtcacacacgcccagatcatctaccagagcaaaaaacagggcaacatactc
acttaccatagacgtatctctttgggaagcggagaccgtccacggcggaaatcaaagatt
atacactttgtccagcaccacagtgaataa

DBGET integrated database retrieval system