KEGG   Mus musculus (house mouse): 71200
Entry
71200             CDS       T01002                                 
Symbol
Dydc2, 4933428D01Rik
Name
(RefSeq) DPY30 domain containing 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Dpy-30 zf-NPL4 Mustang Imm35 NeuB E7 PilO
Other DBs
NCBI-GeneID: 71200
NCBI-ProteinID: NP_001347537
MGI: 1918450
Ensembl: ENSMUSG00000021791
Position
14:complement(40770914..40795036)
AA seq 139 aa
MDTAYLKNCFGTGLTQALAEVARVRPSDPIEYLAHWLYHYRSITVAEEKRRQEELQLKEA
RDRSAEEAKTTEMLKEEGYQIQQKCEKCHQELPSTSFSSDKTPALQEDTAPLEEKTMRQE
SQPGASRVISEMPQRAIPS
NT seq 420 nt   +upstreamnt  +downstreamnt
atggatactgcctacctgaagaactgctttggaaccggcctgacccaggcactggcagag
gtggcaagagtgcggcccagtgacccaatagagtacctggctcactggctttaccattat
aggagtataactgtagctgaggaaaagagaaggcaagaggagctacagcttaaggaagca
cgtgacagaagcgctgaggaagcaaaaacaacagaaatgctgaaagaagaaggctatcag
attcagcagaagtgtgaaaagtgtcaccaggaactgccctcgacctctttttcctcagac
aagaccccagccctgcaggaagacacggcaccccttgaggagaagactatgaggcaggaa
tctcaaccgggtgcctcgcgtgtgatttctgagatgcctcaaagggctattccctcataa

DBGET integrated database retrieval system