KEGG   Mus musculus (mouse): 71206
Entry
71206             CDS       T01002                                 

Symbol
Katnal2, 3110023G01Rik, 4933439B08Rik
Name
(RefSeq) katanin p60 subunit A-like 2
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    71206 (Katnal2)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     71206 (Katnal2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     71206 (Katnal2)
SSDB
Motif
Pfam: AAA AAA_lid_3 LisH RuvB_N AAA_16 TIP49 AAA_5 AAA_22 AAA_14 AAA_24 Mg_chelatase AAA_7 IstB_IS21 RNA_helicase AAA_33 AAA_18 AAA_25 DUF815 TsaE PhoH
Other DBs
NCBI-GeneID: 71206
NCBI-ProteinID: NP_001355584
MGI: 1924234
Ensembl: ENSMUSG00000025420
Vega: OTTMUSG00000033989
Position
18; 18 E3
AA seq 539 aa
MELSYQTLKLTHQAREAYEMRTEARRKNLLILILHYLTQEGYMDAAKALEEETKLGLRRF
EVCDNVDLETILMEYESYYFVKFQKYPKVVKKAPDPVENNLPSRSGGKNKRLTNDSCQNL
PKICHQKSRPKTSAVKTGDTKSVKEHLKQVKESVTDTQAESTDFGLNISKIHKDQPEEKA
QPRRGQIIDFRGLLSDAIKGATSEFALNTFECNPDPSERLLKPLSAFIGMNSEMRELAAV
VSRDIYLHNPNIKWNDIIGLDAAKQLVKEAVVYPIRYPQLFTGILSPWKGLLLYGPPGTG
KTLLAKAVATECKTTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTIFLDELESVM
SQRGMVPGGEHEGSLRMKTELLVQMDGLARSEDLVFVLAASNLPWELDCAMLRRLEKRIL
VDLPSQEARQAMIYHWLPPVSKNHALELHTQLEYSVLSQETEGYSGSDIKLVCREAAMRP
VRKIFSVLENNQSESNNLPGIQLDTVTTQDFLDVLAHTKPSAKNLTERYLAWQEKFESV
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggagctttcttaccagactctcaaactcactcaccaggcgcgggaggcgtacgagatg
agaacagaagcacggcgaaaaaatcttctcattctgattttgcattacttaacacaagaa
ggctacatggatgcagctaaggctttggaggaggagaccaaactgggattacggcgcttt
gaagtttgtgacaacgttgacctggaaactattttgatggaatatgagagctattatttt
gtaaagttccagaagtaccccaaagtggttaagaaggccccggacccagtggaaaataat
ttaccgtcacgaagtggagggaagaacaaaaggctgacgaatgacagttgtcaaaatctc
cccaagatatgtcaccagaagtcacgacctaaaacttcagcagtgaagacaggggacacc
aaatctgtcaaggaacaccttaaacaggtcaaggagagtgtcactgacactcaagcagag
agcactgacttcggcctgaacatatcaaaaatccacaaagaccagccagaggaaaaggcc
caaccacgaagaggccaaatcattgacttccgaggactgctctcagacgctatcaaagga
gccacaagtgaatttgcattgaacacctttgaatgtaacccagacccttcagagcgattg
ctgaaacctctgagtgcatttattggcatgaacagtgagatgcgagaactggcagcggtg
gtgagccgggacatttatctccataatcccaacataaagtggaatgacattattggactg
gacgcagccaagcagctagtcaaagaagccgttgtgtacccaataagatacccgcagctc
ttcacaggaattctttccccgtggaaaggactgctgctttacggccccccaggcacaggg
aagactttgctggccaaagcggtggccaccgaatgcaaaaccaccttctttaacatttct
gcatccactattgtcagcaaatggagaggagattccgaaaaactggtccgggtgctgttt
gaacttgcgcgatatcatgccccctccacgatcttcctggatgagctggagtcggtgatg
agtcagagaggcatggttcctgggggggaacatgaagggagccttcggatgaagacggag
ttactggtgcagatggatggcttagcacgctcggaggatctcgtgtttgtcttagcagcc
tcaaacctgccatgggagctggactgtgccatgttgcggcgcctggagaagaggattctg
gttgatctccccagccaagaggccagacaagccatgatctaccactggctgccgcctgtg
agcaagaaccatgccctggagctacacacacagctggagtacagcgtgctgagccaggaa
acagagggctactcaggctccgacattaagctggtctgcagggaggcagccatgcggcct
gtgcgaaagatcttcagtgtgcttgaaaacaaccagtcagagagcaacaatttacctggg
atccagctggacactgtgaccacacaggactttctggatgttttggctcacaccaagcct
tcagcaaagaatctgaccgagagatacttggcctggcaagagaagtttgagtctgtataa

DBGET integrated database retrieval system