KEGG   Mus musculus (mouse): 71223
Entry
71223             CDS       T01002                                 

Gene name
Gpr15, 4933439K08Rik
Definition
(RefSeq) G protein-coupled receptor 15
  KO
K08403  G protein-coupled receptor 15
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    71223 (Gpr15)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   Chemokine like
    71223 (Gpr15)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx TctB
Other DBs
NCBI-GeneID: 71223
NCBI-ProteinID: NP_001156427
MGI: 1918473
Ensembl: ENSMUSG00000047293
UniProt: Q0VDU3
Position
16; 16 C1.2
AA seq 360 aa
MEPATALLIVDYYDYTSPDPPFLETPSHLSYTSVFLPIFYTVVFLTGVVGNFILMIALHF
KRGNRRLIDIFIINLAASDFIFLVTVPLWMDKEASLGLWRTGSFLCKGSSYVISVNMHCS
VFLLTCMSMDRYLAIMHPALAKRLRRRSSAYAVCAVVWIISCVLGLPTLLSRELTHIEGK
PYCAEKKPTSLKLMWGLVALITTFFVPLLSIVTCYCCITRRLCAHYQQSGKHNKKLKKSI
KIVIIAVAAFTVSWVPFNTFKLLAIVSGFQPEGLFHSEALQLAMNVTGPLAFASSCVNPL
IYYVFDSYIRRAIVRCLCPCLKTHNFGSSTETSDSHLTKALSNFIHAEDFIRRRKRSVSL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaaccagcaacagccctgctgattgtggattactatgactacacaagcccagatcct
cctttcctggagactccctcccacctgtcctacacatctgtcttcctccctatcttttac
acagttgtattcttgactggagtggtggggaatttcatcctcatgatagctctgcatttc
aaacgcggcaaccgaagattgatcgacatctttatcatcaacctggctgcctctgacttc
attttccttgtcacagtgcctctttggatggataaggaagcctctctaggactatggagg
actggctctttcctgtgcaaaggcagctcctatgtgatctccgtgaacatgcactgtagt
gtcttcttgctcacatgcatgagcatggaccgttacctggctatcatgcacccagcctta
gccaagagattacgaaggagaagctctgcatatgcagtgtgtgccgtcgtctggatcatc
tcatgcgtcctggggttgcccactcttctgtccagggagctcactcacattgaaggcaaa
ccatactgtgcagagaagaaacccacgtccttaaaactgatgtggggcctggtagccttg
attaccacctttttcgtccccctcctgagcattgtgacctgctactgttgcatcacaagg
aggctgtgtgctcattaccagcagtcgggaaagcataacaagaaactaaagaagtccata
aagatcgttattattgcggtggcggccttcaccgtctcctgggtaccctttaacactttc
aagctcctagccattgtttcagggttccagccagaaggcctttttcactccgaggctttg
cagctggccatgaatgtgactgggcccttggcctttgccagcagctgtgtcaaccctctc
atttactatgtctttgacagctatatccgccgggccattgtacgttgtctgtgcccttgt
ctgaagacccacaactttgggagcagcactgagacatcggacagtcacctcactaaggct
ctttccaacttcattcatgcagaggatttcatccggcggaggaagagatctgtgtcactc
taa

DBGET integrated database retrieval system