KEGG   Mus musculus (mouse): 71228Help
Entry
71228             CDS       T01002                                 

Gene name
Dlg5, 4933429D20Rik, T25557, mKIAA0583
Definition
(RefSeq) discs large MAGUK scaffold protein 5
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 Takusan dbPDZ_assoc PDZ_2 Guanylate_kin SH3_2
Motif
Other DBs
NCBI-GeneID: 71228
NCBI-ProteinID: NP_001156985
MGI: 1918478
Ensembl: ENSMUSG00000021782
Vega: OTTMUSG00000036719
UniProt: E9Q9R9 Q3UH41 Q6NXJ3
Position
14; 14 A3
AA seq 1921 aa AA seqDB search
MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLQLL
LAKEQDHFQDLRAALEKTQPHLLPILYLNGVVGPPQSTEGAGSTYSVLSIMPSDSESSSS
LSSVGTTGKAPSPPPLLTEQQANDTVENLSIQLRLMTRERNELRKRLAFATHGATFDKRP
YHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTQL
KDDVDMLRRENGKLRRERNLLQQSWEDMKRLREEDQKEIGDLRAQQQQVLKHNGSSEILN
KLYDTAMDKLEVVKKDYDALRKRYSEKVAMHNSDLSRLEQLGEENQRLQKQTEMLTQQRD
TAIQLQHQCALSLRRFETIHHELSKATAQNKDLQWEMELLQSELTELRSKQVKTAKESEK
YKEERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAASEEMEALRQI
KDTVTMDAGRANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSI
RTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMECQLEKEARFRQLM
AHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEGVNEPCFPGDCGIFVTKVD
KGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEGAINMVVRRRKSLGGKVVTPL
HINLSGQKDSGISLENGVYAAAVVPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESL
LRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDRMLSCRAHGPEVQAHNKRNLLQHNN
STQTDIFYTDRLEDRKELGHSGGSSSFLHKPFSGSSSPVSPQACPSTSERSLNSFRSDTS
AERGYGLVDMRSQRPLLSFETEVGPCGAVEVPLDKIDPEGSNSGGTWPKAVLGSTSGPEK
LSVYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGLTHSPQPSKRVGSLTPPKPPRRSD
SIKFQHRLETSSESEATLVGSSPSTSPPSAPPPSMDPSEPTHASPPRKARVRIASSYHSE
GDGDTSYLPAKKPCDEDLTSQKVDELGQKRRRPKSAPSFRPKISPVVIPAQCLEEQECVP
AIGELSPEGQEWSPYSPGHASRHGNPLLYPNRPSVGTVPRSMTPGTTVGSILRNPIYTVR
SHRVLPCGSPPVPRDAGSQSLSPSVQHQGRLSLDLSHRACSDYSEMRASQGSNSLPSSAR
LGSSSNLQFKAERIKIPLTPRYPRSVMGSDRGSLSHSECSTPPRSPLNIDTLSSCSQPQT
TASTLPRIAVNPSSHGERRKDRPFVEEPRHVKVQKGSEPLGISIVSGEKGGVYVSKVTLG
SIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILAQYNPHIHQLNSHSRS
SSHLDPAATPHSTLQGSSAGTPEHPSVIDPLMEQDEGPGTPPAKQSASSTRSVGDTTKKT
PDPRIVFIKKSQLDLGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDMRS
RTVEDVYVEMLKPKDSLRLKVQYRHEEFTRVKGLPGDSFYIRALYDRLAEVEPELSFKKD
DILYVDDTLPQGVFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNTAK
TLSAAARRSFFRRKHKHKRSGSKDGKDLLALDTFSNDSIPLFEDSVSLAYQRVQKVDCTS
LRPVLLLGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHF
DVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIRYKSAKHIKEQRDPVYLR
DKVTQRHSKEQFETAQKIDQEYSRYFTGVVQGGALSSICTQILAMVSQEQSKVLWIPACP
P
NT seq 5766 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcagcgccgggagctgctcgcccagtgtcagcagagcctggcccaggccatg
accgaggtggaggccgtgcttgggctgctggaggcagcaggagcgctgagccccggcgag
cggcggcagctggacgaggaggcgggaggcgccaaggcggagctgctgctccagctcctc
ctggccaaggagcaggaccacttccaggacctgcgcgccgccctggagaagactcagcct
cacctgctgcctattctctacctgaacggcgtcgtcgggccgccgcagtctacagagggc
gcggggtccacctacagcgtcctgtccatcatgccctcagactcggagagcagcagctcc
ctcagcagtgtggggactactgggaaggcaccgtccccaccacccctcctcaccgagcag
caggccaatgacacggtggagaacctctccattcaactaaggctgatgacccgtgagagg
aatgagctacgcaagcgcctggccttcgccacccatggagccacctttgacaaaaggccc
taccacaggctgaatcctgattatgagaggctaaagatccagtgtgtgcgggccatgtcg
gacctgcagagcttacagaaccagcacaccaacgccttgaagaggtgcgaggaggtggcc
aaggagacagacttctatcacaccctccacagccggctcctgagtgaccagacgcagctg
aaggacgatgtggacatgctgagacgggagaacgggaagctgcggagggagcgcaatctg
ctgcagcagtcctgggaggacatgaagcggctccgggaagaggaccagaaggagataggt
gacctccgggcccagcagcagcaggtgctgaagcacaatggctcatcagagatcctcaac
aagctgtacgacacggccatggacaagctggaggtagtcaagaaggactacgatgccctg
cggaagagatacagcgagaaggttgccatgcacaactcggacctgagccgcctggagcag
ctgggggaggagaaccagcgtctgcagaagcagacggagatgctgacccagcagagggac
acggccatccagttacagcaccagtgcgcactctccctgaggaggtttgagacgatccac
catgagctgagcaaggccacagcccagaacaaggacctgcagtgggagatggagctgctg
caatccgagctcacggagctgaggagcaagcaggtgaaaaccgccaaggagtcagagaaa
tacaaggaggagcgcgatgctgtgtacagcgagtacaagctcatcatgagcgaacgcgac
caggtcatctccgagctggacaagctacagacagaggtagagctggccgagtccaagctc
aaaagcagcacatccgagaagaaggcagccagcgaggagatggaggccctgcggcagatc
aaagacacagtgaccatggatgctgggagagccaacaaagaggtggaaatcctccgaaaa
cagtgtaaggccttgtgccaggagctgaaggaagccctccaggaagcagacgtggccaag
tgccggcgggactgggcctttcaggagcgggacaagattgtggcagagcgtgacagcatc
aggaccctgtgtgacaacctgaggcgggagcgagatcgagctgtgagtgagctggctgaa
gcccttcgcagcctggatgacactcggaagcagaagaatgacgtcagccgggagctcaag
gagctcaaggagcagatggaatgtcagctggagaaggaggcccgattccggcagctgatg
gcccacagttcgcacgactcagccatcgacacggattccatggagtgggagacagaagtt
gtggaatttgagagagagacggaggatattgacttgaaagcacttgggtttgacatggca
gaaggcgtgaatgagccttgtttcccaggggattgcggcatatttgttactaaagtggat
aaaggaagcattgctgatggtcgcttaagggtcaacgactggctgctgagaatcaacgat
gtagacctcatcaacaaggacaagaaacaggccatcaaggcactcctcaacggagaggga
gccatcaacatggttgtgaggcggaggaagtccctgggtgggaaggtcgtcacacctctg
cacatcaacctcagtggacagaaagacagtggcatcagtttggagaatggagtgtatgct
gccgcagtggtgcctggaagcccggctgccaaagaggggtccctcgccgtgggagacagg
attgttgcgatcaacggtattgcactggacaataagtctctaaatgaatgtgaatctctg
ctgcgcagctgtcaagactccttgaccctctccctcctgaaggtgtttccccagagctcc
tcatggagtggccagaacatctttgaaaatatcaaggactcagataggatgctgagttgc
cgagcccacggcccagaggtccaggcgcataacaaacggaacttgttacagcacaataat
tccacgcagacagacattttctacacggatcggctggaggacaggaaggagctgggacat
tctggaggcagcagttcttttctccacaagcccttctctggatcctcgtctccagtctcc
cctcaggcctgtcctagcacctctgagcgtagtctgaactcattccgctctgatacctct
gcagaacgtggctatgggctggtggatatgcggagccagcggccactgctgtcttttgag
actgaggtgggcccctgtggggcagtagaggttcccctggacaagatagatccagagggc
tccaatagtggtgggacctggcccaaggctgtgcttggctccacatcagggcctgagaaa
ctctctgtgtataagaaacccaaacaaaggaagtccatctttgacccaaatactttcaag
cgcccacagacaccccccaaaatagactacctgcttccaggccctgggcttactcattcc
ccccagccctccaagagggtaggatctctgacacccccaaagccccccaggagaagtgac
tctatcaagttccaacacaggctggagaccagttctgagtcagaagccactttggtgggc
agctcaccttccaccagccctcccagtgccccaccccccagcatggatcccagtgagccc
acgcatgcttcacctcctcggaaggccagggtccgcattgcctccagctaccactctgaa
ggggacggagacacctcctacctgcccgccaagaagccttgtgatgaagacctcacctcc
cagaaagtcgatgagctggggcagaaacggcgccggccaaagtctgccccaagttttcgg
cccaagatctctccagtggtgatccctgctcagtgcctggaggaacaggagtgtgttcca
gccatcggagagctctccccagagggtcaggaatggtccccgtactcaccagggcatgct
agccggcatggcaaccccctactctaccccaaccggccatctgtgggcaccgttccccgg
agtatgacccccggcaccactgtgggctccattctgaggaaccccatttatactgtgcgc
agccacagggtgcttccctgcggctcaccacccgtgccccgtgatgctggctcccagagc
ttgtctcccagtgtccagcatcagggacgcctcagcctggacctgagccacagggcctgc
agtgactactctgagatgagagcctcccagggttccaactctctgccctccagtgcccgc
cttggctcttccagtaacctgcagttcaaggctgagcggattaagatcccgctaacacca
agatatccccggtctgtcatgggctctgacagaggctcactgtcacattctgaatgtagc
actcctccccggtccccgctgaatatcgacaccctgtcctcctgtagccagcctcagacc
acagcctccactttacccaggattgcggtcaacccctcttcccatggggagcggaggaag
gacaggccttttgtggaagagccacgccacgtgaaggtgcagaagggttcagagcctctg
ggtatctccatcgtgagtggagaaaagggtggtgtctatgtctccaaggtgaccctgggg
agcatcgctcatcaagctggacttgagtatggggaccagttacttgagttcaatggcata
aacctgagaagtgccaccgagcagcaggcccggctcatcatcggacagcagtgtgacacc
atcaccatcctggcccagtacaacccacacatccaccagctcaacagccactcccgctcc
agctctcatctggacccagctgctacccctcactctactctccagggcagcagtgctggg
accccagaacatccctctgtcatcgacccactgatggaacaggatgaaggtcctggcacc
cccccagccaagcaaagcgcctccagcaccaggagtgtgggagataccaccaagaagacc
cctgatccccgcattgttttcatcaagaaatcccagctggatctgggggtgcacttgtgt
ggtgggaacctgcacggagtgtttgtggccgaagtggaagatgacagtcctgccaagggt
cctgatggcctcgtcccaggagacctcatccttgagtatggcagcctggatatgcgcagc
aggacagtggaggacgtctatgtggagatgctgaagcctaaggatagccttcgcctgaag
gtgcagtaccgccatgaggagttcaccagggtcaagggcctgcccggagacagcttctac
atcagggccctatatgaccgtctggcagaggtggagcctgaactgagttttaagaaagat
gacatcctgtacgtggatgatacgttgccccagggcgtgtttgggtcctggatggcctgg
cagctggatgagaatgcccagaagatccagcgtgggcagattcccagcaaatacgtgatg
gaccaagagttctcccggaggctcagcatgtctgaggtcaaagatgacaacacagccaag
acgctgtcagcagctgcgcgccgttccttcttccgaaggaaacataaacataaacgcagt
gggtccaaagacggcaaggacctgctcgccctggacaccttttccaacgactccattcct
ctctttgaagactcagtgagcctggcctatcagcgggtccagaaagtggactgtacctct
cttcggcctgttctcctcctgggacctttactggatgtggtgaaagagatgctggtgaat
gaggcacctggcaagttctgcagatgcccacttgaggtgatgaaggcttcccagcaagcc
attgagcggggtgtcaaagactgcctgtttgtggactacaagcggaggagtggccatttt
gatgttactactgtggcttcaataaaggagatcacagaaaagaaccggcactgtcttctg
gacatcgccccgcatgccatcgagaggctgcaccacatgcacatctaccccattgtcatc
ttcatccgctacaagagcgccaagcacatcaaggaacagagagaccctgtctacctgagg
gacaaggtgacacagaggcattccaaagagcaattcgaaacagcacagaagatcgatcag
gagtacagcaggtacttcacaggggttgtccagggtggagccctgtccagcatttgcact
cagatcctggccatggtcagtcaagaacaaagtaaagtcctgtggatccccgcttgccca
ccctag

DBGET integrated database retrieval system