KEGG   Mus musculus (house mouse): 71242
Entry
71242             CDS       T01002                                 
Symbol
Spata24, 2700012K08Rik, 4930583E11Rik, 5133400G04Rik, AU016220, TIPT, TIPT2
Name
(RefSeq) spermatogenesis associated 24
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SPATA24 ERM_helical DUF4335 Fib_alpha
Other DBs
NCBI-GeneID: 71242
NCBI-ProteinID: NP_083761
MGI: 1918492
Ensembl: ENSMUSG00000024352
UniProt: Q6P926
Position
18:complement(35789742..35795239)
AA seq 205 aa
MATPLGWSQGGSGSVCLAFDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFHEIEKKL
VEEKAAHAKTKALLAKEEEKLQFALGEVEVLSKQLEKEKMAFEKALSSVKSRVLQESSKK
DQLITKCNEIESHIIKQEDILNGKENEIKELQQVISQQKQNFRNHISDFRIQKQQETYMA
QVLDQKRKKATGMRRARSRQCSREK
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgacgccccttgggtggtcgcaggggggctctggatcagtgtgtctcgccttcgat
caactgcgggacgtgattgaatctcaggaggaacttatccaccagctgaggaatgtgatg
gttctccaggatgagaattttgtcagtaaagaagaattccatgaaatagagaagaaactg
gtggaggagaaagctgctcatgccaaaaccaaagccctcctggccaaggaagaagagaag
ttacagtttgctctgggagaggtggaggtgctgtccaagcagctggagaaagagaagatg
gcctttgaaaaagcgctctccagtgtcaagagcagagtcctgcaggagtccagcaagaag
gaccagctcatcaccaagtgcaatgaaattgaatcccacattataaagcaagaagatata
cttaatggcaaagagaatgagattaaagagttgcagcaggttatcagccagcagaaacag
aatttcaggaatcacatatctgacttccggatccaaaagcagcaggagacctacatggcc
caggtgctggatcagaagcgtaagaaagccacaggaatgcgtcgggcccgtagccgtcag
tgttccagggagaaataa

DBGET integrated database retrieval system