KEGG   Mus musculus (mouse): 71254
Entry
71254             CDS       T01002                                 

Symbol
Naif1, 2310007O20Rik, 4933440H19Rik
Name
(RefSeq) nuclear apoptosis inducing factor 1
  KO
K23221  nuclear apoptosis-inducing factor 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    71254 (Naif1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   Transposable elements
    71254 (Naif1)
SSDB
Motif
Pfam: Myb_DNA-bind_5 MADF_DNA_bdg Peptidase_S68
Other DBs
NCBI-GeneID: 71254
NCBI-ProteinID: NP_919316
MGI: 1918504
Ensembl: ENSMUSG00000039164
Vega: OTTMUSG00000011985
UniProt: Q6PFD7
Position
2; 2 B
AA seq 327 aa
MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVAT
CRRELPEVKKKWSDLKTEVRRKVAQVRAAVEGGEAPGPTEDDGAGGPGTGSGSGGSGTAI
APVLLTPMQQRICNLLGEATIISLPSTTEIHPVALGSTATTAAATVTLTQIPTETTYHTL
EEGVVEYCTAEAPPPLPTEAPVEMIAQPPDTSVKPQALKSRIALNSAKLIQEQRVTNLHI
KEIAQHLEQQNGLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYL
QNNTPNPAPASAPGPVAQNGQPDSIIQ
NT seq 984 nt   +upstreamnt  +downstreamnt
atggctgtcccagccaagaagaggaagatgaacttttcagagcgggaagtggagatcatc
gtggaggaactggaactgaagaagcacctgctggtgaaccacttcaatgctggggtccct
ctggctgccaagagtgcagcctggcatggcatcctgagaagggtcaacgctgtggccacc
tgccgtagggagctgcccgaagtcaagaagaagtggtccgacctcaagaccgaggtccgt
cgcaaggttgcccaagtccgagctgctgtagaaggtggcgaagctccagggcccacagaa
gatgatggagctggtgggcctgggacaggcagtggcagtggtggcagtggcacagccata
gctcctgtactgctgacccctatgcaacagaggatctgcaacctgttgggtgaggccacc
atcatcagcctacccagtaccacagagatccatcccgtggccctcggatccacggccact
acagccgcagccaccgtcaccctgacacagatccccaccgagaccacctaccacacgctg
gaggagggagtggtggagtactgcacagctgaagcgcccccacccctgccaacagaggcc
ccggtggagatgatagcccagcccccagacacatctgtcaaaccacaggcacttaaaagc
cgtattgccctcaattcagccaagctgatccaggagcagcgggtcaccaacctgcacata
aaggagatcgcccagcacctggagcagcagaatggcctgctacagatgatccggcgttct
caggaggtgcaggcctgtgcccaggaacggcaggcccaggccatggagggcactcaggcg
gccctgagtgtcctcatccaggtcctccggcccatgattaaagatttccgacgctaccta
cagaataacactcccaacccagccccagcctctgcccctggaccggtggcccagaatggg
cagccagacagcatcatccagtga

DBGET integrated database retrieval system