KEGG   Mus musculus (house mouse): 71275
Entry
71275             CDS       T01002                                 
Symbol
Noxred1, 4933437F05Rik
Name
(RefSeq) NADP+ dependent oxidoreductase domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: F420_oxidored 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 71275
NCBI-ProteinID: NP_082020
MGI: 1918525
Ensembl: ENSMUSG00000072919
UniProt: Q9D3S5
Position
12:complement(87267897..87285375)
AA seq 366 aa
MEMLEDLESLRFEFGIPEEERYWLYLQGRYRGLMIKGCAHAAFFCKMFSTLSNLLQNLPR
TIHPRTVSFDNAATEDELLTVGIIGCGHLGKQLTNVLLKTVPIPAENLQISTRRPESLGE
LRKLGVRCVYDNAAVASWAKVLFLCCLPAQLPNICLEIQSKLNKHCTVYSFVSAIPLPRL
KSLLNHTNILRPQYQFAEDYDNIWGENEEVPIALQDTTIIRGTCPYNNLGGVILNVKWIE
GLCYALINACTSRSVFHSQVLKLLNKLLLPMHLESCTTDPESCPQFNLTDFMSKSYVKNL
YQKRPFPWFDLTTVQLKETPFSQHISATPSLQDHISLLYCEVFGLTISEEELPYISTVIR
PLVEEK
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggaaatgctagaagaccttgagtctctgaggtttgagtttgggattccagaggaagaa
cgttactggctgtacttacagggccgttatcggggattgatgatcaagggctgtgcccat
gcagccttcttctgcaaaatgttctctactttgagcaacttattgcagaatctgccacgc
acaatacatccccggactgtgtcatttgataacgccgctactgaggatgaactgctaacc
gtgggcatcattgggtgtggccaccttggaaagcagctgactaatgtattgctgaaaacc
gtccctatccctgccgagaacctgcagatctccactaggaggccagagtccctgggtgag
ttacggaaactaggggtccggtgcgtctatgacaacgctgctgtggcgagctgggccaaa
gtgttgttcctctgctgtctgcctgcccagctgcctaatatctgcctagaaattcaatcc
aaactcaacaagcactgcaccgtgtacagctttgtatccgccattccgctacccaggttg
aaaagtttactgaaccacaccaatatcctgaggccccagtaccaatttgctgaggattat
gacaacatctggggagagaatgaggaggtcccaattgctctccaagatacaacgattatc
cggggtacctgcccctacaataatcttgggggagtaatccttaatgtcaagtggatagag
gggctgtgctatgccctcatcaatgcctgtacgtcaaggagcgtgtttcactcacaggtg
ctgaagcttctaaacaaactgcttctccctatgcacttagaaagctgcacgacagaccca
gaatcctgcccccagtttaatttaacagatttcatgagcaaaagctacgtcaaaaacttg
tatcaaaaaaggcctttcccctggtttgatctgactactgtgcaactcaaggaaactcct
tttagccagcacatctcagccactccttctcttcaggaccacattagtcttttgtactgt
gaagtatttggcctcaccataagcgaagaagaattgccttatatttccacagttatccgg
cccctagtagaggagaaatga

DBGET integrated database retrieval system