KEGG   Mus musculus (mouse): 71279Help
Entry
71279             CDS       T01002                                 

Gene name
Slc29a3, 4933435C21Rik, AW987637, Ent3
Definition
(RefSeq) solute carrier family 29 (nucleoside transporters), member 3
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    71279 (Slc29a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    71279 (Slc29a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   71279 (Slc29a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 71279
NCBI-ProteinID: NP_076085
MGI: 1918529
Ensembl: ENSMUSG00000020100
Vega: OTTMUSG00000030007
UniProt: Q99P65
Position
10; 10 B4
AA seq 475 aa AA seqDB search
MAFASEDNVYHSSNAVYRAPSNHQEADQEALLGKLLDYPAPGLQRPEDRFNGAYIIFFCL
GIGGLLPWNFFVTAKEYWAYKLRNCSSPASGEDPEDMDILNYFESYLAVASTVPSLLFLV
ANFLLVNRVQVHVRVLASLSVSLAIFVVMIVLVKVDTSSWTRGFFSLTIACMAIISSSST
IFNSSVYGLTGSFPMRNAQALISGGAMGGTVSAVALLVDLAASSDVRDSTLAFFLMAAVF
LGLCMGLYLLLSQLEYARYYMRPVAPVRVFSGEDNPSQDAPSASSVAPASRVMHTPPLGP
ILKKTASLGFCAVSLYFVTAFIIPAISTNIQSMHKGTGSPWTSKFFVPLTVFLLFNFADL
CGRQVTAWIQVPGPRSKLLPGLVVSRFCLVPLFLLCNYQPRSHLTKVLFQSDIYPVLFTC
LLGLSNGYLSTLVLIYGPKIVPRELAEATSVVMLFYMSVGLMLGSACAALLEHFI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgcctctgaggacaatgtataccacagctccaatgctgtctacagagccccg
agtaaccatcaagaagctgaccaggaagccctgctggggaaactactagactacccagcc
ccgggcctgcagaggccagaggatcgcttcaatggtgcctacatcatcttcttctgcctg
ggaattgggggcctactgccctggaacttctttgtcactgctaaggagtactgggcatat
aaactccgaaactgctccagcccagcgtccggggaggaccctgaggacatggacatcctg
aactactttgagagctacctggcagttgcctccactgtgccctccctgctgttcctggtg
gctaacttcctgcttgtcaacagggtccaggtgcacgtccgtgttctggcctcactgtcc
gtgtccctggccatcttcgtggttatgattgtgctggtgaaggtggatacttcctcctgg
acccgaggcttcttcagcctcaccatcgcgtgcatggccatcattagcagctcctccacc
atcttcaatagcagcgtttacggcctcacaggctccttccccatgaggaatgcccaggca
ctgatatcaggaggagccatgggagggacagtcagtgccgtggccttgctggtggacctg
gcagcatccagtgatgtgcgggacagcacgctagccttcttcctcatggcagcagtcttc
cttgggctctgtatgggactctatctattgctgtcccaactggagtatgccaggtactac
atgaggccagttgccccagttcgagtgttttctggtgaagacaacccatcccaggatgct
cccagcgcctcctctgtggcccctgcatccagagtgatgcacacaccgccccttggaccc
atcctgaagaagacggctagcctcgggttctgcgcagtttccctctactttgtcacggcc
ttcatcatccccgccatctccaccaatatccagtccatgcacaaaggcaccggctctcca
tggacctccaagttcttcgtgcccctcaccgtcttcctcctcttcaactttgctgacctc
tgcggccgacaggtcacagcctggatccaggtgccaggtcctaggagcaagctgctcccc
ggactggtggtctctcggttctgccttgtgcctctcttcttgctctgtaactaccagccg
cgctcacacttgaccaaggtgcttttccagtcggacatctacccagtgcttttcacctgc
ctcctggggctcagcaacggctacctcagcacgctggtgctcatctatgggcccaagatt
gtgccccgggagctggctgaggccaccagtgttgtgatgttgttctatatgtctgtgggc
ttgatgctgggctcagcctgcgcggccctgcttgaacactttatctag

DBGET integrated database retrieval system