KEGG   Mus musculus (mouse): 71302Help
Entry
71302             CDS       T01002                                 

Gene name
Arhgap26, 1810044B20Rik, 2610010G17Rik, 4933432P15Rik, AI853435, mKIAA0621
Definition
(RefSeq) Rho GTPase activating protein 26
  KO
K20071  Rho GTPase-activating protein 26
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71302 (Arhgap26)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    71302 (Arhgap26)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    71302 (Arhgap26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 RhoGAP PH SH3_9 SH3_1 IMD SH3_2
Motif
Other DBs
NCBI-GeneID: 71302
NCBI-ProteinID: NP_780373
MGI: 1918552
Ensembl: ENSMUSG00000036452
Vega: OTTMUSG00000020314
UniProt: Q6ZQ82 Q9D0J3 Q3U860
Position
18; 18 B3
AA seq 814 aa AA seqDB search
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFAAVLRNLEDERSRMIENASEVLITPLEKFR
KEQIGAAREAKKKYDKETEKYCGTLEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITM
VPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLW
MEAMDGREPVYNSNRDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRV
QKLLSVLMDPKAASETETDICAEWEIKTVTSALKTYLRMLPGPLMMYQFQRSFIKAAKLE
NQETRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQ
EETVAAIMDIKFQNIVIEILIENHEKIFNTVPDVPLTNAQLHLSRKKSSDSKPPSCSKRP
LTLFHAVPSTEKQEQRNSIINSSLESVSSSANSILNSSSSLQPNLNSSDSNLDVVKPSRP
SSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAGFVWFSVAAVVLSLAWS
SLHAVFSLLVNFVPCHPNLHLLFDRPEEAVREDSSTPFRKAKALYACQAEHDSELSFTAG
TVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggggctcccggcgctcgagttcagcgactgctgcctcgacagccctcacttccgagag
acgctcaagtcacacgaagcggagctggacaagaccaacaaattcatcaaggagctcatc
aaggacgggaagtcgctcatcagcgcgctcaagaatttgtcttcggcaaagcggaagttt
gcagattccttaaatgaatttaaatttcagtgtataggagatgccgaaacagatgatgag
atgtgtatagcgagatctttgcaagaatttgctgctgttctcaggaatcttgaagacgag
cggagtcgaatgatcgagaatgccagcgaggtgctcatcacacccttggagaagtttcga
aaggagcagattggggccgccagggaagccaaaaagaagtatgacaaagagaccgagaag
tactgcggcaccttagaaaaacatttgaatttgtcttccaaaaagaaggaatcccagcta
caggaggcagacagccaagtggacctggttcggcaacatttctacgaagtatccctggag
tatgtctttaaggtgcaggaagtgcaagagagaaagatgtttgagtttgtagagcctctg
ctggccttcctgcaaggactcttcactttctatcaccatggttatgagctggccaaggat
tttggtgactttaagacacagttgaccatcagcatacaaaatacaagaaaccgctttgaa
ggaaccaggtctgaggtggaatcgctgatgaagaagatgaaggaaaaccccctggagcac
aagaccatcagcccgtacaccatggaagggtacctgtacgtgcaggagaagcgtcacttt
ggaacttcctgggtgaagcactactgtacctaccaacgggattccaaacaaatcaccatg
gttccattcgaccaaaagtcaggaggaaaggggggagaagacgagtccgttaccctcaaa
tcctgcacacggcgaaagacagactccatcgagaagcgattctgctttgacgtggaagca
gtagacaggccaggggttatcaccatgcaggcgttgtcggaagaggaccgtaggctctgg
atggaagccatggatggccgggaacctgtgtacaactccaacagagacagccagagcgaa
gggaccgcacaattggacagtatcggcttcagcataataaggaaatgcatccatgcggtg
gagaccagagggatcaatgagcaggggctctaccgaatcgtgggggtcaactccagggtg
cagaagttgctgagcgtcctgatggaccccaaagcagcttctgagacagaaactgatatc
tgtgccgaatgggagataaagaccgtcaccagtgctctgaagacctacctgagaatgctc
ccaggacccctcatgatgtaccagtttcaaagaagtttcatcaaagcagcaaagctggaa
aaccaagagactcgagtgtctgagatccacagtcttgtccatcggctcccggagaagaat
cggcagatgttgcagctgctcatgaaccacctggccaatgttgctaacaaccacaagcag
aatctgatgactgtggcaaacctgggcgtggtgtttggacccaccttgcttcggcctcag
gaagaaactgtggcggccatcatggacatcaagtttcagaacattgtcatcgagatctta
atcgagaaccatgagaagatattcaacacggtgcctgatgtgcccctcaccaacgcccag
ctacacctgtcccggaagaaaagcagtgactccaagcccccatcctgcagcaagaggccc
ctgacgctcttccatgctgtgccatccacagaaaaacaggagcagaggaacagcatcatc
aactccagtttggaatcggtctcctcgagtgcaaacagcatccttaactctagcagcagc
ctgcagcccaatctgaattccagcgactcaaacctggatgtggtcaaacctagtcggccc
agttcactccccccgaatccaagcccaacttcacccctctcgccatcatggcccatgttc
tcggcaccatccagccctatgcccacctcatccacgtccagcgactcatcccccatcagg
tctgtggcagggtttgtttggttttctgttgctgccgttgttctctcattggcttggtcc
tctcttcatgcagtgttcagcctcctcgtcaactttgttccctgccatccaaacctgcac
ttgctttttgacaggccagaagaagcggtccgtgaagactccagcacaccattccggaag
gcaaaggctttgtacgcctgccaagctgagcacgactcggagctctccttcacagcgggc
accgtcttcgataatgttcatccatctcaggagcctggctggttggaggggactctgaat
ggaaagactggcctcatcccagagaactacgtggaattcctctaa

DBGET integrated database retrieval system