KEGG   Mus musculus (mouse): 71313Help
Entry
71313             CDS       T01002                                 

Gene name
Fsip1, 1700012M13Rik, 4933432K11Rik
Definition
(RefSeq) fibrous sheath-interacting protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FSIP1
Motif
Other DBs
NCBI-GeneID: 71313
NCBI-ProteinID: NP_082035
MGI: 1918563
Ensembl: ENSMUSG00000027344
Vega: OTTMUSG00000015226
UniProt: Q9D3V5
Position
2; 2 E5
AA seq 435 aa AA seqDB search
MPMDIIKGNLDGISKPASSSRSRPGSRSSNGSLEVLTPEPGSVKIDMVNKLNSGQEGHTS
NSGVEERRNSNDAKWADDSKTKPAKESSDEDPDMPQPQATPEHSDDPKLEETNAVLQNAI
RKMHRLDKLLAKKQCREKEVKKQGLEMRVKLWEELKSAKNTEDLENDEELGNTKKFLCLT
SESAGKAAAEALHCEFEDALFSVFHTQIPPETYENLMEKDFTCDVEKNEPLIITEKQPFS
NTEAIEPRSEDSQGFIRQNAEHSQDFIKRNIELAKHSRSPVVMVEGEKKRLDELLQGLDD
ADSGLSSAEGDQCGWLVPGEGYTLAATESQQLAEIDIKLQELSVDSPTIFSLESQSHKGD
MECDANEERNTEPTPGEKILRDRKEQRDRESRLRAIDGKLKELSEQVEECPMITPSKRNE
RITWRWLLAKILEPE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccaatggatattataaaggggaacctagacggaatttcaaaaccagcctcaagttca
agatcacgtcctgggagccgaagttcaaatggttctctggaggtgctcacaccagaacca
gggtctgtcaagattgacatggtaaacaagttgaattctggccaagagggccacacatca
aacagtggtgtggaagaaagaaggaatagtaatgatgctaagtgggcagacgactccaag
acaaaaccagccaaggagagctcagatgaagacccggacatgcctcaacctcaggcgacc
cctgagcattcagatgatcccaaattagaagagacgaatgctgtacttcaaaatgctatt
cgtaagatgcacagactcgacaagctattggccaaaaaacaatgtagagaaaaggaagtt
aaaaagcaaggtctagaaatgagagttaagctgtgggaagagctcaagtctgcaaaaaac
actgaagacttagaaaatgacgaggagttgggaaacacaaaaaagtttttgtgcttgact
tcagaatctgcagggaaagcagctgcagaggcattgcattgtgagtttgaagacgccctt
ttctcagtgtttcatactcagattcctccagaaacttacgaaaatctcatggagaaagat
tttacctgtgatgtggagaaaaatgaaccattgatcataacagaaaagcaaccattttca
aatacagaagcgattgagcctaggagtgaagacagccagggtttcattaggcagaacgct
gaacacagccaggattttattaagcgaaacattgagttggccaagcattcgagaagccca
gtggtcatggttgaaggagagaagaaaagactggatgagctcctgcaaggcctggatgat
gcagactcaggactctccagtgccgagggcgatcagtgcggttggctggttccaggagaa
ggctatacccttgcagccactgagtctcagcagcttgctgagattgacataaagcttcag
gaactctctgttgactctcccaccatcttcagccttgaaagtcagagccataagggtgat
atggaatgtgatgccaatgaagaaagaaatacggaaccaactcccggagagaagatactc
cgggaccgcaaagagcaaagggaccgggagtctcggctgagagccatcgatggcaagctg
aaagagctcagtgaacaggttgaggaatgtccaatgataacccccagtaaacggaatgag
cggattacgtggagatggctacttgctaaaatccttgagccagagtga

DBGET integrated database retrieval system