KEGG   Mus musculus (mouse): 71351
Entry
71351             CDS       T01002                                 

Symbol
5430402E10Rik, OBP2
Name
(RefSeq) RIKEN cDNA 5430402E10 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Lipocalin Transthyretin
Other DBs
NCBI-GeneID: 71351
NCBI-ProteinID: NP_082044
MGI: 1918601
Ensembl: ENSMUSG00000044121
Vega: OTTMUSG00000017873
UniProt: Q9D3N5
Position
X; X B
AA seq 173 aa
MVKFLLIVIALGVSCAHHESLDISPSEVNGDWRTLYIAADKVEKVKMNGDLRAYFEHMEC
NDDCGTLKVKFHVQMNGKCQTHTVVGEKQEDGRYTTDYSGRNYFEVVMKEDGALFFHNVN
VDESGQETNVILVAGKGETLSKAQKQELGKLVKEYNIPKENIQHLAPTDTCNQ
NT seq 522 nt   +upstreamnt  +downstreamnt
atggtgaagttcctgctaattgtgattgcattaggtgtatcctgtgcacatcatgaatct
cttgatatcagtccctcagaggttaatggggactggcgcaccctttacatagctgcagac
aaggtggagaaagtaaagatgaatggagacctgagagcgtattttgagcatatggagtgc
aatgacgactgtgggacactcaaagtcaaattccatgtccagatgaatggcaagtgtcag
acacacactgttgtgggagaaaaacaagaagatgggcggtacactactgactactctggt
agaaattacttcgaagttgtaatgaaggaagatggcgcccttttctttcacaacgttaat
gtggatgagagtggacaggagacaaatgtgattttagttgctggaaaaggagagaccctg
agcaaagcacagaagcaggagcttgggaagctggtcaaggaatacaatattccaaaggag
aatatccagcacttggcacccacagacacttgtaaccaataa

DBGET integrated database retrieval system