KEGG   Mus musculus (house mouse): 71351
Entry
71351             CDS       T01002                                 
Symbol
5430402E10Rik, OBP2
Name
(RefSeq) RIKEN cDNA 5430402E10 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Lipocalin Transthyretin zinc_ribbon_6
Other DBs
NCBI-GeneID: 71351
NCBI-ProteinID: NP_082044
MGI: 1918601
Ensembl: ENSMUSG00000044121
Position
X:complement(76963392..76968668)
AA seq 173 aa
MVKFLLIVIALGVSCAHHESLDISPSEVNGDWRTLYIAADKVEKVKMNGDLRAYFEHMEC
NDDCGTLKVKFHVQMNGKCQTHTVVGEKQEDGRYTTDYSGRNYFEVVMKEDGALFFHNVN
VDESGQETNVILVAGKGETLSKAQKQELGKLVKEYNIPKENIQHLAPTDTCNQ
NT seq 522 nt   +upstreamnt  +downstreamnt
atggtgaagttcctgctaattgtgattgcattaggtgtatcctgtgcacatcatgaatct
cttgatatcagtccctcagaggttaatggggactggcgcaccctttacatagctgcagac
aaggtggagaaagtaaagatgaatggagacctgagagcgtattttgagcatatggagtgc
aatgacgactgtgggacactcaaagtcaaattccatgtccagatgaatggcaagtgtcag
acacacactgttgtgggagaaaaacaagaagatgggcggtacactactgactactctggt
agaaattacttcgaagttgtaatgaaggaagatggcgcccttttctttcacaacgttaat
gtggatgagagtggacaggagacaaatgtgattttagttgctggaaaaggagagaccctg
agcaaagcacagaagcaggagcttgggaagctggtcaaggaatacaatattccaaaggag
aatatccagcacttggcacccacagacacttgtaaccaataa

DBGET integrated database retrieval system