KEGG   Mus musculus (mouse): 71354Help
Entry
71354             CDS       T01002                                 

Gene name
Wdr31, 5430402I10Rik, spWD
Definition
(RefSeq) WD repeat domain 31
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Frtz
Motif
Other DBs
NCBI-GeneID: 71354
NCBI-ProteinID: NP_001277450
MGI: 1918604
Ensembl: ENSMUSG00000028391
Vega: OTTMUSG00000000235
UniProt: Q9JHB4
Position
4; 4 B3
AA seq 367 aa AA seqDB search
MLLLDGQLKPALPQKVFCRLWAVMGKLQSKLRHSTYLYSRPDGIIEERVQTKAPQEYIPV
HVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHEREITKIACIPKANQFFS
ASRDKTVLMWDLQGSSHPRQQLSGHAMVVTGLAVSPDSSQLCTGSRDNSLLLWDVGTGQC
VERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQMAHMFPTKQHIQTHCEVSV
DGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTVASCVFLPKSTALMPMIATS
AHDSKVKIWNQDTGACLSTLSLDGSGPLTSLAVGDISSLLCASFYRGVHLLRVDHSQGLE
LQEVAAF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttgttacttgacggccaactgaaaccagctcttcctcagaaggtcttctgtagactc
tgggctgtgatgggaaaactgcagagcaaactcagacacagcacttacttatacagcagg
cctgatggaattatagaagagagagtccagactaaagctccccaagaatacatccctgtt
cacgtggataccgtctctgtgattgccactctgaactcagacctttgtatctctggagga
aaagacaagaccgccgtggcctacaattggaaaactgggcgtatggtgaaaaggttcaca
gggcacgagcgggaaatcacgaagatagcctgtattcccaaagcaaaccagttcttcagc
gcctctcgagacaagacagtcctgatgtgggatctgcagggctcctcgcaccctaggcag
cagctgtctggccatgccatggtggtcactggcttggctgtgagcccagactcgtcccag
ctgtgcactggctctcgggacaatagcctgcttctgtgggatgtggggaccggacagtgt
gtggagagagcgtctgtctccaggaacctggtcacacacctgtgctgggtcccgagtgag
ccatacatagtccagacctctgaggataagaccatcagattatgggacagtcgggggctt
cagatggctcacatgtttcccacaaaacagcatatccagacccattgtgaagtcagcgtg
gatggacacacgtgtatttcctgcagcagtggctttgggggtgaaggctgtgaagccacg
ttgtgggacctaagacagactagagacagaatgtgtgagtataaggggcatttccagaca
gttgcatcctgtgtctttctaccgaagtccacggccttgatgcctatgattgctacctct
gcacatgactccaaggtgaagatttggaaccaggatactggagcttgcctctccaccttg
tctctggatggatcaggacccctgacctcactggctgttggtgacatctcctccttgtta
tgcgcaagtttctacagaggagttcacttactcagagtggaccacagccaaggactggaa
ctgcaggaagtggcagccttctaa

DBGET integrated database retrieval system