KEGG   Mus musculus (mouse): 71382
Entry
71382             CDS       T01002                                 

Gene name
Pex1, 5430414H02Rik, E330005K07Rik, ZWS, ZWS1
Definition
(RefSeq) peroxisomal biogenesis factor 1
  KO
K13338  peroxin-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    71382 (Pex1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71382 (Pex1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    71382 (Pex1)
SSDB
Motif
Pfam: AAA PEX-2N PEX-1N AAA_lid_3 AAA_16 AAA_14 AAA_22 RuvB_N ABC_tran AAA_19 Sigma54_activat AAA_2 AAA_33 Sigma54_activ_2 RNA_helicase TIP49 AAA_24 AAA_5 AAA_18 AAA_29 T2SSE DUF815 AAA_7 Mg_chelatase Bac_DnaA IstB_IS21 AAA_30 NACHT NTPase_1 CobU AAA_10
Other DBs
NCBI-GeneID: 71382
NCBI-ProteinID: NP_001280735
MGI: 1918632
Ensembl: ENSMUSG00000005907
Vega: OTTMUSG00000028545
UniProt: Q5BL07
Structure
PDB: 
1WLF

Position
5; 5 A1
AA seq 1284 aa
MWSSDRLAGAGSGGAVVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVASDHQPTYLSW
VEGRHFNDQSENVAEINRQVGQKLGLSSGDQVFLRPCSHVVSCQQVEVEPLSADDWEILE
LHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVTLMPAAPYGRLETNTKLLIQPK
TRQAKESTFPKEGDAHGQVHSYGREQKGLSKELQTRQLHTNSEGITASNGRDPKVPGGPL
KPSWWAVLGSMLSFGPDSKQESAWGSLELGAFKNMQSQAAPLEGTFRVCQVQPPSARTTT
ATSVFHKHCTAHVFPWDQEYFDVEPSFTVTYGKLVKLHSPKQQQDKSKQGVLLPDKEKQL
SKSPDHKQISSNRSEEAAEACVLKVVWNGLEELKNATEFTESLELLHRGKVWIPDDLRKR
LNIEMHAVVRITPLETTPKIPRSLKLQPRENLPKDVNEETIKTVFSSWVQQSATTMLPLV
ISKEERIKLEIKDGLREFSLSTVHSQEKEKEEGKTVFVLSSILLQKISVQVLLEPMIKEE
QSAEIDFLLPSLTLSSLGGVSALGASAMEHITHSLLGRPLSRQLMALVAGLRNGALLITG
GKGSGKSTFAKAICKEAQDTLDARVETVDCKALRGKRLESIQKALEVAFSEAAWRQPSVI
LLDDLDLIAGLPSVPEQEHSPEAVQSQRLAHALNDMIKEFVSTGSLVALIATSQLQQSLH
PSLVSAQGIHTFQCVQHLQPPNPEQRCEILHSVVKNKLGCDISNFPDLDLQCIAKDTEAF
VARDFTVLVDRAIHSSLSRQHSSSREDLTLTTSDFQKALRGFLPASLRNVNLHKPRDLGW
DKIGGLHEVRQILMDTIQLPAKYPELFANLPIRQRTGILLYGPPGTGKTLLAGVVARESG
MNFISIKGPELLSKYIGASEQAVRDVFIRAQAAKPCILFFDEFESIAPRRGHDNTGVTDR
VVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILTV
LSKSLALADDVDLQHVASVTDSFTGADLKALLYNAQLEALQGRLLPSGLPDGGSSSDSDL
SLSSMVFLNHSSGSDDSAGDGECGLEQSLLSLEMSEILPDESKFNMYRLYFGSSYESELG
NGTPSDLSSHCLSAPSSVTQDLPAAPGKDPLFTQHPVFRTPSQEGCQDLTQEQRDQLRAE
ISIIKGRYRSQSGEDESLNQPGPIKTTFAISQAHLMTALAHTRPSISEDEGKEFAELYEN
FQNPKKRKNQSGTVFRTGQKVTLA
NT seq 3855 nt   +upstreamnt  +downstreamnt
atgtggagcagcgatcgcttagcgggtgcggggtctggtggggcggtcgtgacggtggcc
ttcacgaatgctcgggactgcttcctgcatctgccgcggcgcctcgtggcccagcttcac
ctgctgcagaatcaagctatagaagtggccagcgatcaccagcctacctacctgagctgg
gtggaaggcaggcattttaatgatcaaagtgaaaatgtggcagaaattaatagacaagtt
ggccagaaacttggactctcaagcggagatcaggtgtttctcaggccttgttcccatgtg
gtatcttgccaacaggttgaagtggagcctctctcagcagatgactgggaaatactggag
ctgcacgccatttcccttgaacagcatcttctggatcagattcgaatagttttccccaaa
gctgttgttcccatctgggttgaccagcagacctacatatttatccagatcgtcactctg
atgccagctgccccttatggaaggctagaaactaacaccaaactccttattcagccaaag
acacgccaagccaaagagagcacatttccaaaagaaggagatgcacacggacaagttcat
agttatgggcgagaacagaaaggattgtcaaaggaattacaaaccaggcagcttcatacg
aactcagagggtatcactgcatccaatggaagagacccaaaagtcccaggtggcccgttg
aagccaagctggtgggctgtgctcggaagcatgctttcctttgggcctgacagtaaacag
gagtcagcctggggctcgttggaactcggtgctttcaaaaacatgcagtcacaggctgcc
cctctggaaggtactttcagagtatgccaagtccagccacctagtgcgcgtaccaccacc
gctacctctgtgtttcacaaacactgcaccgcccacgtatttccttgggaccaagaatac
tttgatgtggagcccagctttactgtgacctatggaaaactagttaagctacattctcca
aaacaacagcaagacaaaagtaagcagggtgtcctgttgcctgacaaagagaagcagctg
tccaagtctccagatcataagcagatcagctccaaccgcagtgaggaggctgctgaggcc
tgtgtgctgaaggtagtctggaatggactcgaggagttgaagaatgccacagagttcacc
gaaagtctagagcttctccaccgtgggaaagtctggattccagatgacctgagaaagaga
ctaaatatagaaatgcatgcagtagtcagaataactccactggaaaccacgcctaaaatc
ccaagatctctgaaattacaacctagagagaacttacctaaagacgtcaatgaagaaact
ataaaaacagtgttctcatcttgggtacagcagtccgctaccacgatgcttcctttggta
atatcaaaggaagagcgtattaagctggaaattaaagatgggctgagagagttctctctg
agtacagttcattctcaggaaaaagaaaaggaagaaggaaaaactgtgtttgtgttgagt
tccatcctgctgcagaagatctcagtacaagtccttctagagcccatgataaaagaagaa
cagagtgcggaaatcgactttcttcttccctctttaacgctgagctctttggggggagtg
agtgccttaggtgcatctgcaatggagcacatcactcacagtctcctgggacgcccgttg
tctaggcagctgatggccctcgttgcaggacttaggaatggcgctcttttgatcactgga
ggaaagggaagcgggaagtcaacattcgcgaaagccatctgcaaggaagcacaggacact
ctggatgcccgtgtggagacagtcgactgcaaggctttacgaggaaaaaggcttgaaagc
atacaaaaagcgctagaggtggctttctcagaggccgcctggaggcagccatctgtcatt
ctgctggatgacctggacctcattgccggactgccaagtgtccccgagcaggagcacagc
cctgaagcggtgcagagccagcggcttgcacatgctttgaacgatatgatcaaagagttt
gtttccacgggaagcttggtggcactcatcgccacgagccagctccagcagtctctgcac
ccttcccttgtgtctgctcaaggaatccacacgtttcaatgtgtccagcaccttcagcct
cccaatccggaacagagatgtgaaattctgcacagtgttgtgaagaataaactgggctgt
gatataagcaatttccctgacttggacctgcagtgcatagctaaagacacagaagcgttt
gtggctcgtgactttacagttcttgtggaccgagccatacactcttctctctctcgccag
catagctcctctagggaagacttgactttaacaacatcagacttccaaaaggctctccgt
ggattccttcctgcttctctgcgaaatgtcaacttgcataaacctagagacctgggctgg
gacaagattggtggattacatgaagttcggcagatcctcatggatactatccagttacca
gccaagtacccagaattatttgcaaacttacccatacgacagaggacaggaatactgctt
tatggtcctccagggacaggaaaaactttacttgctggggtagttgcaagagagagtgga
atgaattttattagtattaagggaccagagttactcagcaaatatattggcgcaagtgag
caagctgttcgagatgttttcatcagagcacaggctgcaaagccctgcattcttttcttt
gatgagtttgagtccatcgctcctcgaagaggccatgacaacacaggggttacagaccga
gtagtcaaccagttgctgacacagttagacggagtagaaggcttacagggagtttatgtg
ctggctgctactagtcgccctgacttgatcgaccctgccctgttgcggcctggcagactg
gataaatgtgtatactgccctcctccagatcaggtgtcccgtcttgagattttaactgtc
ctcagcaagtctctagctctggcagatgacgtggaccttcagcacgtggcgtcggtcacc
gactcgttcactggagcggatctgaaagctctgctgtacaacgctcagctggaggccttg
cagggacggctgctgcccagtgggcttcccgatggaggctccagctctgacagtgacctg
agtctgtcttcaatggtctttcttaaccacagcagtggttccgacgactccgctggagat
ggagaatgtggcttagagcaatccctgctttctctcgagatgtctgagatccttccagac
gaatcaaaattcaatatgtaccggctctactttggaagctcgtatgaatcggagcttgga
aatgggaccccttctgacttgagctcacactgtctgtctgcaccaagctccgtgactcag
gatttacctgcagctcctgggaaagacccgttatttacacaacatcctgtgttcaggaca
ccttcccaagaaggctgccaagacctcacccaggagcagagagatcagctgagggcagag
atcagcatcatcaaaggcagataccggagccaaagtggagaggatgaatcccttaaccag
cctggaccaatcaaaaccacttttgctattagccaggcacatttaatgactgcacttgcc
cacacaagaccgtctattagtgaagatgaagggaaggaatttgctgagctgtatgagaac
tttcaaaatccaaagaagagaaaaaatcaaagtggaacagtgtttcgaactggacagaaa
gtaactttagcataa

DBGET integrated database retrieval system