KEGG   Mus musculus (mouse): 71436Help
Entry
71436             CDS       T01002                                 

Gene name
Flrt3, 5530600M07Rik, C430047I10Rik, mKIAA1469
Definition
(RefSeq) fibronectin leucine rich transmembrane protein 3
  KO
K16362  leucine-rich repeat transmembrane protein FLRT
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    71436 (Flrt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRR_5 LRRNT fn3 LRRCT TPKR_C2 LRR_1
Motif
Other DBs
NCBI-GeneID: 71436
NCBI-ProteinID: NP_001165631
MGI: 1918686
Ensembl: ENSMUSG00000051379
Vega: OTTMUSG00000015600
UniProt: Q8BGT1
Structure
PDB: 

Position
2; 2 F3
AA seq 649 aa AA seqDB search
MISPAWSLFLIGTKIGLFFQVAPLSVVAKSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDA
TTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEEL
RLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLSAELFDCKDSGI
VSTIQITTAIPNTAYPAQGQWPAPVTKQPDIKNPKLIKDQRTTGSPSRKTILITVKSVTP
DTIHISWRLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPESPYRVCMV
PMETSNLYLFDETPVCIETQTAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
SIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNLSESSSNRSYRDSGIPDSDHSHS
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcccagcctggagcctcttcctcatcgggactaaaattgggctgttcttccaa
gtggcacctctgtcagttgtggctaaatcctgtccatctgtatgtcgctgtgacgcaggc
ttcatttactgtaacgatcgctctctgacatccattccagtgggaattccggaggatgct
acaacactctaccttcagaacaaccaaataaacaatgttgggattccttccgatttgaag
aacttgctgaaagtacaaagaatatacctataccacaacagtttagatgaattccctacc
aaccttccaaagtatgtcaaagagttacatttgcaagagaataacataaggactatcacc
tatgattcactttcgaaaattccgtatctggaagagttacacttggatgataactcagtc
tcggctgttagcatcgaagagggagcatttcgagacagtaactatctgcggctgcttttt
ctgtcccgtaaccaccttagcacaatcccggggggcttgcccaggactattgaggaatta
cgcctggatgacaatcgcatatcaacgatctcttccccatcacttcatggtctcacaagc
ctgaaacgcctggttttagatggaaacttgttgaacaaccatggtttgggtgacaaagtt
ttcttcaacttagtaaacttaacagagctgtccctggtgaggaattccttgacagcagcg
ccagtgaaccttcccggcacaagcctgaggaagctttaccttcaagacaaccatatcaac
cgggtacccccaaatgctttttcttatttaaggcagctgtatcgactcgatatgtctaat
aataacctaagcaatttacctcagggtatctttgatgatttggacaatataacccaactg
attcttcgcaacaatccttggtattgtggatgcaagatgaaatgggtacgagactggtta
cagtcgctaccggtgaaggtcaatgtgcgtgggctcatgtgccaagccccagaaaaggtc
cgtggaatggctatcaaggacctcagtgcagaactgtttgattgtaaagacagtgggatt
gtgagcaccattcagataaccactgcaatacccaacacagcatatcctgctcaaggacag
tggccagctcctgtgaccaaacaaccagatattaaaaaccccaagctcattaaggatcag
cgaactacaggcagcccctcacggaaaacaattttaattactgtgaaatctgtcacccct
gacacaatccacatatcctggagacttgctctgcctatgactgctctgcgactcagctgg
cttaaactgggccatagcccagcctttggatctataacagaaacaatcgtaacaggagaa
cgcagtgaatacttggtcaccgccctagaacctgaatcaccctatagagtatgcatggtt
cccatggaaaccagtaacctttacctgtttgatgaaacacctgtttgtattgagacccaa
actgcccctcttcgaatgtacaaccccacaaccaccctcaatcgagagcaagagaaagaa
ccttacaaaaatccaaatttacctttggctgccatcattggtggggctgtggccctggta
agcatcgccctccttgctttggtgtgttggtatgtgcataggaacgggtcactgttttca
cggaactgtgcgtacagcaaagggcggaggagaaaggatgactatgcagaagccggtact
aagaaagacaactccatcctggaaatcagggaaacttctttccagatgctaccgataagc
aatgaacccatctccaaggaggagtttgtaatacacaccatatttcctccgaatgggatg
aatctgtacaagaacaacctcagtgagagcagtagtaaccggagctacagagacagtggc
atcccagactcggaccactcacactcatga

DBGET integrated database retrieval system