KEGG   Mus musculus (mouse): 71449Help
Entry
71449             CDS       T01002                                 

Gene name
Eef1aknmt, 5630401D24Rik, Mettl13
Definition
(RefSeq) EEF1A lysine and N-terminal methyltransferase
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Spermine_synth Methyltransf_12 Methyltransf_23 Ubie_methyltran MTS TPMT Methyltransf_32 PrmA MetW
Motif
Other DBs
NCBI-GeneID: 71449
NCBI-ProteinID: NP_659126
MGI: 1918699
Ensembl: ENSMUSG00000026694
Vega: OTTMUSG00000022659
UniProt: Q91YR5
Position
1; 1 H2.1
AA seq 698 aa AA seqDB search
MNLLPKSSKEFGSADYWEKFFQQRGKTAFEWYGTYLELCEVLHKYIKPKEKVLVIGCGNS
ELSEQLYDVGYQDIVNIDISEVVIKQMKERNGSRRPHMSFLKMDMTQLEFPDATFQVVLD
KGTLDAVLTDEEEVTLRQVDRMLAEVGRVLQVGGRYLCISLAQAHILKKAVGHFSREGWM
VRAHQVASSQDRVSEAEPRFSLPVFAFVMTKFRPVPGSALQIFELCTQEQGKPVRLESAD
QLAEAVRERQYYAWLCSQLRRKAGLGSVSLDLCSGDTGEPRYTLHVVDNPAVKPSRDNHF
AIFIIPQGRETEWLFGMEEGRKQLAASAGFRRLVTVALHRGQRYAGMESIQAELSARVME
LAPAGLPPQQQVPFLSVGGDIGVRTVQHQDHSALSGDYVIEDVQGEDRWYFRRLIFLSNR
NVVQSEARLLKDTSHRAQKKRKKDRKKQRPADTSEDFPPAPGQSIDKSYLCCEHHKAMVA
GLALLRNPELLLETPLTLLVVGLGGGSLPLFVHDHFPKSRIDAVEIDPTMLEVATQWFGF
SQSDRMKVHIADGLDYITSLAGEAPPHYDVIMFDVDSKDPTLGMSCPPPAFVDQVFLQKV
KSILCHDGVFILNLVCRDVRLKDSVLAGLKAAFPLLYVRRIEGEVNEILFCQLHPEQKLA
TPELLEMAQVLERTLRKPGQGWDDTYVLSDMLKTVKIV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcctacctaaaagctccaaggagtttggctctgccgactactgggagaagttc
ttccagcagcgagggaagacagctttcgagtggtatgggacctatctggagctgtgcgag
gtgctgcacaaatacataaagcccaaggaaaaggtgcttgtgatcggatgtggcaactca
gagctcagtgaacaactctatgatgtgggctatcaggatatcgtgaacatcgacatcagc
gaggttgtcatcaagcagatgaaggaacgcaatggcagccgacggccccacatgagtttc
ctgaagatggacatgacccagctggagtttcctgacgccacattccaggtggtgttggac
aagggcacgctggatgctgtcctgacagatgaggaggaggtgaccctgcgtcaggtggac
aggatgctagctgaggttggccgtgtcctgcaggtgggcggtcgctacctctgcatctcc
ctggctcaggctcacatcctgaagaaagcagtgggccacttctctcgggaggggtggatg
gtgagggcacaccaagtggccagcagccaggaccgggtgtctgaagccgagccccgcttc
tccctgcccgtctttgccttcgtcatgactaagttcaggccagtccctggctctgccctt
cagatctttgagctgtgtactcaggagcagggcaagcccgtaaggctggagagtgctgat
cagctggcggaggctgtgcgggagcgccagtactatgcttggctgtgtagtcagctgcgc
cgcaaagccgggctggggagtgtgtccctggacttgtgcagtggggacacgggggagcca
cgctacaccctccacgtggtggacaaccccgctgtgaaaccatcgcgggacaatcatttt
gccattttcatcatcccccagggtcgcgagaccgagtggctctttggcatggaggagggc
cggaagcagctggcagccagtgcgggcttcaggaggttggtcacagtggctctccaccga
ggccagcggtatgctggcatggaaagcattcaagcagagttgtcagccagagtcatggag
ctggccccggctgggttgcctccccagcagcaggtgcccttcctgtctgtgggtggggac
attggggtccggactgtgcagcaccaagaccacagtgccttgagtggtgactatgttatt
gaggatgtgcaaggggaagacagatggtactttcggcggctcatcttcctcagcaacagg
aacgtggtgcagtcggaagccaggctgctgaaggatacgtctcacagagcccagaagaaa
cggaaaaaggacaggaaaaaacagcgacctgctgatacttctgaggacttcccgcctgcc
ccagggcagtccatcgataagagttacctgtgctgtgaacaccataaagccatggttgct
ggccttgccctgctgagaaaccccgagctactcttagagactccactgacattgctggtg
gtgggtctgggtggaggtagcctccctctcttcgttcacgatcatttcccgaagtcccgc
atcgatgctgttgagattgaccccacaatgttggaagtggccactcagtggtttggcttc
tcacagagcgaccggatgaaggttcacattgcagatggtcttgactacattaccagcctg
gcaggagaagcgccgcctcactatgatgtgataatgtttgatgtagacagtaaggatccg
acgctggggatgagctgtcctcccccagcatttgtggaccaagttttcctgcagaaggtc
aaaagcatcctgtgtcacgacggcgtcttcatccttaacctcgtgtgtcgggacgtgagg
ttaaaggactcagtgctggctggactcaaggcagccttccctctcctctatgtccggcgg
attgaaggcgaggtgaatgaaatcctgttttgtcagctgcatccagaacagaaacttgct
acaccagagctcctggaaatggcccaggttttggagcggaccctgcggaagcctgggcag
ggttgggatgacacgtatgttctgtcagatatgctgaagactgtgaagattgtgtga

DBGET integrated database retrieval system