KEGG   Mus musculus (mouse): 71461Help
Entry
71461             CDS       T01002                                 

Gene name
Ptk7, 8430404F20Rik, chz, mPTK7/CCK4
Definition
(RefSeq) PTK7 protein tyrosine kinase 7
  KO
K05127  PTK7 protein tyrosine kinase 7 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    71461 (Ptk7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    71461 (Ptk7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     71461 (Ptk7)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  CCK family
   71461 (Ptk7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   71461 (Ptk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Pkinase_Tyr Ig_2 ig Pkinase V-set Ig_6 C2-set_2 C1-set BiPBP_C
Motif
Other DBs
NCBI-GeneID: 71461
NCBI-ProteinID: NP_780377
MGI: 1918711
Ensembl: ENSMUSG00000023972
UniProt: Q8BKG3
Position
17; 17 C
AA seq 1062 aa AA seqDB search
MGARPLTLLRALLLPLLAGAQAAIVFIKEPSSQDALQGRRALLRCEVEAPDPVHVYWLLN
GVPVQDTERRFAQGSSLSFAAVDRLQDSGAFQCVARDNVTGEEVRSTNASFNIKWIEAGP
VVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDDQSTHTVSSRERNLTLR
PASPEHSGLYSCCAHNAFGQACSSQNFTLSVADESFARVVLAPQDVVVARNEEAMFHCQF
SAQPPPSLQWVFEDETPITNRSRPPHLRRAVVFANGSLLLTQVRPRNAGVYRCIGQGQRG
PPIVLEATLHLAEIEDMLPFEPRVFIAGDEERVTCPAPQGLPTPSVWWEHAGVPLPAHGR
VHQKGLELVFVTIAESDTGVYTCHASNLAGQRRQDVNITVATVPTWLRKPQDSQLEEGKP
GYLHCLTQATPKPTVIWYRNQMLISEDSRFEVSKNGTLRINSVEVYDGTLYRCVSSTPAG
SIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTVKWVRADGSSLPEWV
TDNAGTLHFARVTRDDAGNYTCIASNEPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHT
ALLRCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGSYTCIAGN
SCNIRHTEAPLLVVDKPVMEDSEGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKK
RCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPPATNKRHSAGDR
MHFPRASLQPITTLGKSEFGEVFLAKAQGVEEGATETLVLVKSLQSRDEQQQLDFRREVE
MFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKNKDEKLKSQPLSTKQKV
ALCSQVALGMEHLSNNRFVHKDLAARNCLISAQRQVKVSALGLSKDVYNSEYYHFRQAWV
PLRWMSPEAVLEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQ
PEGCPSKLYRLMQRCWAPNPKDRPSFSEIASTLGDSPADSKQ
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccgcccgctgactctgctcagagccctgcttctgccgctgctggccggtgcc
caagccgctatcgtctttatcaaggagccgtcctcccaggatgcacttcaagggcgccgg
gcgctgctccgttgtgaagtggaggctccggacccggtgcacgtgtactggctgctcaat
ggggtgcctgtccaggacacggagcgacggtttgcccagggcagcagcctgagtttcgca
gctgtggaccggctccaggattctggtgctttccagtgtgtggctcgggataacgtcact
ggagaggaagtccgcagtactaatgcctccttcaacatcaaatggatcgaagcaggtcct
gtggtcctgaagcacccagcctcagaagctgagatccagccccagacccaggtcacactg
cgatgtcacattgacgggcaccctcggcctacctaccagtggttccgagatgggaccccc
ctctctgatgatcagagcacccacaccgtcagcagcagggagaggaacctgaccctacgg
ccagccagtcccgaacatagtggcctctactcctgctgtgcccacaatgcctttggccag
gcctgcagcagccagaacttcaccttgagtgttgcagatgaaagctttgccagggtggtg
ctggcacctcaggatgttgttgtagcaaggaacgaggaggccatgttccattgccagttt
tcagcccagccacccccgagcctgcagtgggtctttgaggacgagactcccatcactaac
cgaagccgtccccctcacctccgcagagctgtggtgtttgccaatggctctctgctgctg
acccaagtccggccacggaatgcaggcgtctaccgttgcatcggtcagggacagaggggc
ccacccattgtcctggaagccactctccacctggcagagattgaagacatgctgccgttt
gaaccacgggtgttcatagctggtgatgaggaacgagtcacctgcccagccccccagggc
ctgcctacacccagtgtctggtgggagcatgctggagtccctcttcctgcccatggcagg
gtccaccagaagggccttgagcttgtgtttgtcaccatcgctgagagtgatactggtgtc
tacacctgccatgcaagcaacctggctggtcagcggcgacaggatgtcaatatcacagtg
gccactgtacccacatggcttaggaagccccaagacagccagctggaagagggcaagcct
ggctacttgcactgtctgacacaggccacacccaagcccactgtgatctggtacaggaac
cagatgctgatctcagaggactcgaggttcgaagtttcgaagaatgggaccttgcgcatc
aatagtgtggaggtgtatgacgggacattgtaccgttgcgtgagcagtaccccagccggc
agcatcgaggcccaggcccgagtccaggtgctggaaaaactcaagttcacgccaccaccg
cagccacagcagtgcatggagtttgataaggaggctacggtgccctgctcagccactggc
cgggagaagcccacggttaagtgggtacgggcagatggaagtagcctccctgaatgggtg
acagacaatgctggaaccctacactttgcccgagtgacccgagatgatgctggcaactac
acttgcattgcatccaacgagccacagggccagatccgcgctcatgtccagctgacggtg
gcagttttcatcaccttcaaagtggaacctgagcgtacaactgtgtaccagggccacaca
gcgctgctgcggtgtgaggctcagggcgaccccaagcctctcattcagtggaaaggcaaa
gaccggatcctggaccctaccaagctgggacccaggatgcacatcttccagaacggttcc
ctggtgatccatgacgtggcccctgaggactcaggctcctacacctgcatcgctggcaac
agctgtaacatcaggcacacagaggccccgctcttagtcgtggacaagccagtgatggaa
gactcggagggcccaggcagccctcccccatacaagatgatccagaccatcgggctgtcg
gtgggcgcagcggtagcctacatcatcgcggtcctgggcctcatgttctactgcaagaag
cggtgtaaagccaagcggctgcagaaacagcctgagggggaggagccagagatggagtgc
ctcaatggtgggcctttgcagaatggtcagccatcagccgagatccaggaagaagtggcg
ttgaccagcttgggctctggccccccagccaccaacaagcgccacagcgccggtgatagg
atgcatttcccgagagccagcctgcagcctatcaccactctggggaaaagcgagttcggg
gaggtgttcctggcaaaggcgcagggcgtagaggaaggcgcgacggagaccctggtcctc
gtgaagagcctgcagagcagggacgagcaacaacagctggacttccggagagaggtggag
atgttcgggaagttgaaccatgccaacgtggtgcggcttctggggctgtgccgggaggct
gagccccactacatggtgctggagtatgtggacctgggagatctcaaacagttcctgagg
atttccaagaacaaggatgaaaagttgaagtcacagcccctcagcaccaaacagaaggtg
gccctgtgttcccaggtggccctgggcatggagcacctgtccaacaaccgctttgtgcac
aaggacttagcggctcgcaactgcctgatcagtgcccagaggcaggtgaaggtgtccgca
ctgggcctgagcaaggatgtatacaacagtgagtactaccacttccgccaggcctgggta
cctctgcgttggatgtctccagaggctgtcctggagggtgacttctccactaagtctgat
gtctgggcctttggtgtgctcatgtgggaagtgttcactcatggagagatgccccatggt
ggacaggcagatgatgaggtgctggcagacttgcaggctggcaaggctcgactcccgcag
cccgaaggctgcccgtctaagctctaccggctgatgcagcgctgctgggccccgaacccc
aaggaccggccctccttcagtgagatcgccagcaccctgggagacagccctgcagacagc
aagcagtga

DBGET integrated database retrieval system