KEGG   Mus musculus (mouse): 71517Help
Entry
71517             CDS       T01002                                 

Gene name
Vps35l, 2610029J22Rik, 9030624J02Rik, Vsp35l
Definition
(RefSeq) VPS35 endosomal protein sorting factor like
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4698 IL4
Motif
Other DBs
NCBI-GeneID: 71517
NCBI-ProteinID: NP_082091
MGI: 1918767
Ensembl: ENSMUSG00000030982
Vega: OTTMUSG00000025727
UniProt: Q8BWQ6 I1E4X5
Position
7; 7 F2
AA seq 991 aa AA seqDB search
MASGAGPSFPGCEKRGWTRKTGDHVTGKMAVFPWHSRNRNYKAELASCRLETVPLECGDY
HPLKPITVTESKTKKVSRKGSTSSTSSSSSSSVIDPLSSVLDGTDPLSMFAATSDPAATG
TVTDSSRKKRDKDENSFVGPDFEPWANKRVEILARYTTTEKLSINLFMGSEKGRGGAAAS
AMSEKVRTRLEELDDFEEGSQKELLNLTQQDYVNRIEELNQSLKDAWASDQKVKALKIVI
QCSKLLSDTSVIQFYPSKFVLITDILDTFGKLVYERISSMCVDSRSALPDHFSPENVNDT
AKETCLNWFFKIASIRELIPRFYVEASILKCNKFLSKTGISECLPRLTCMIRGIGDPLVS
VYARAYLCRVGIEVAPHLKESLNKNFFDFLLTFKQIHGDTVQNQLVAQGVELLSYLPLYS
PAMGWIFQCVSYHAPEALLTEMMERCKKLGNNALLLNSVMSAFRAEFVATRSMDFIGMIK
ECDESGFPKHLLFRSLGLNLALADPPENDRLQILNEAWKVITKLKSPQDYINCAEVWVEY
TCRHFTKREVNTVLADVIKHMTPDRAFEDSYPQLQSIIQKVIAHFHDFSVLFSVEKFLPF
LDMFQKESVRVEVCKCIMEAFIKHQQEPTKDPVILNALLHICKTMHDSVNALTLEDEKRT
LAHLINGFIKMVSFGRDFEQQLSFYVESRSMFCNLEPVLVQLIHSVNRLAMETRKVMKGN
HSRKTAAFVRACVAYCFITIPSLVGIFTRLNLYLHSGQVALANQCLSQADAFFKAAIGLV
PEVPKTISIDGKLRPSEPFLLEFLCNFFSTLLIVPDHPEHGVLFLVRELLNVIQDYTWED
SSDDKIRIYTSVLHLLSAMSQDTYLYHIDKVDSNDSLYGGDSKFLAENSKLCEAVMAQIL
EHLKTLAKDEALKRQSLLGLSFFNSILAHGDLRNNKLNQLSVNLWHLAQRHGCADTRTMV
KTLDYIKKRSKQPDMNHLSELALRLPLQTRT
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctggggcggggccgagcttccctggatgtgagaaaaggggctggacgcggaaa
acaggcgatcatgtgactgggaagatggctgtctttccctggcattcccggaacaggaac
tacaaggcggagctggcgtcttgcaggttggagacagtgcctctggagtgcggcgactac
cacccgctgaagcccatcactgtcacggagtcaaagacaaagaaagtgagccggaaagga
agcacgtcttctacctcctcctcctcttccagctccgtgatcgatcctctgagcagcgtc
ctcgatggcaccgacccgctctccatgtttgcagccacctcggacccggcagccacagga
acagtcacagacagctccagaaagaaacgtgataaggatgagaactccttcgtgggacct
gatttcgagccctgggccaacaaacgtgtggaaatccttgcccggtacacaactacagag
aagctgtctattaatctgtttatgggatcagaaaaaggcagaggtggggctgcggcttct
gccatgtcagagaaggttcggacgcggctggaagagctggatgactttgaggagggatcc
cagaaggagctgctgaacctgacccagcaggattatgtgaaccgcatagaggagctcaac
cagtctctgaaggatgcctgggcctcggaccagaaggtgaaggctctgaagatcgtcatc
cagtgttcaaagctgctgtcagacacgagtgttattcagttctacccaagcaagtttgtc
ctcatcaccgacatccttgatacgtttggaaagctggtctatgagcgcatctcctcgatg
tgtgtggacagccgcagtgccttgccagatcatttctccccagagaacgtgaacgacaca
gccaaggagacatgcctgaattggtttttcaagatcgcttccatccgggaactcattcca
agattttatgtggaagcatccatcctgaagtgtaacaagttcctctccaaaacggggatt
tcagagtgcctgccccgactaacctgcatgatcagagggatcggagacccactcgtgtcc
gtgtacgcccgggcctacctgtgtcgggtggggatcgaagtggccccgcacctcaaggag
agcctcaataagaacttctttgacttcctgctgacatttaaacagattcatggggacact
gtccagaaccagctggtggcccagggtgtggagctgctgtcctatctccctctgtactcg
cctgccatgggctggatcttccagtgtgtctcctaccacgctccagaggctttgctgacg
gagatgatggaaagatgtaagaaactagggaacaatgctttgctgttgaactccgtgatg
tcagctttcagggctgagttcgttgccaccaggtctatggacttcatcggcatgatcaaa
gagtgtgacgagtccggcttccccaagcatctcctttttcgttcattggggttaaacttg
gctttggctgatcctcctgagaacgatcgacttcagattctcaatgaagcttggaaagtc
atcactaaactgaagagtcctcaggactacattaattgtgccgaggtttgggtagagtac
acctgcaggcatttcacgaaacgagaagttaacactgttctggctgacgtcatcaagcac
atgactccggatcgagcatttgaggactcttacccccagctccagtcaatcattcagaaa
gtcatcgcccacttccacgatttctcagttcttttctcagtggaaaagtttctaccattt
ctggacatgttccagaaagagagtgtgcgggtggaggtttgcaagtgcatcatggaagcc
tttatcaagcaccagcaggagccaaccaaggaccctgtcatcctcaatgcccttttgcac
atttgcaagacaatgcacgactccgtgaacgctctcactcttgaggatgagaaaaggacg
ctggcccacttgatcaatggatttataaaaatggtgtcctttggccgtgattttgaacag
cagctcagcttttacgtcgagtccaggtctatgttttgcaacctggaacctgttcttgtg
cagttgatccatagtgtgaaccggttggcaatggaaacaaggaaagtcatgaagggaaac
cactccagaaagacagctgcgtttgtccgggcctgtgttgcctactgcttcatcaccatc
ccgtccctggtagggatcttcacccgcctcaacctctacctgcattccggtcaggttgcc
ttggccaaccagtgcctctcccaagctgatgctttcttcaaagccgccatcggcctcgtt
cccgaagtcccaaagacgataagcatcgatgggaagctgcggccgtcggagcccttccta
ctggaattcctgtgcaatttcttctctaccttattgattgtgccggatcatccagagcac
ggagtcctatttctggttcgagaacttctcaacgtgatccaggactacacctgggaggac
agtagtgatgacaaaattcgaatctacacctctgtcctgcacctgctgtctgccatgagc
caggacacctatctttaccacatagacaaagttgactccaatgacagcttgtacggggga
gactccaagttcctggctgagaacagcaagctgtgtgaggctgtgatggctcagatcctg
gagcacctgaaaaccctggccaaagacgaggctctgaagcgacagagcctgctgggcctc
tccttcttcaatagcatcctagcccacggggaccttcgtaacaacaagctgaaccaactc
tctgtcaacctatggcacctggcacagagacacggctgtgcagacacaaggactatggtg
aaaactctggattacatcaagaagcgaagcaaacaacctgacatgaatcatctgtcagag
ctggccctgaggctccctctgcaaaccaggacctga

DBGET integrated database retrieval system