KEGG   Mus musculus (mouse): 71521
Entry
71521             CDS       T01002                                 

Gene name
Pds5a, 9030416H16Rik, B230308N11Rik, E230024D05Rik
Definition
(RefSeq) PDS5 cohesin associated factor A
  KO
K11267  sister chromatid cohesion protein PDS5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    71521 (Pds5a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    71521 (Pds5a)
Motif
Pfam: PI-TkoII_IV
Other DBs
NCBI-GeneID: 71521
NCBI-ProteinID: NP_001074790
MGI: 1918771
Ensembl: ENSMUSG00000029202
Vega: OTTMUSG00000055174
UniProt: E9QPI5
Position
5; 5 C3.1
AA seq 1332 aa
MDFTQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSED
EKQQYLPLALHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFIT
RQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHNT
KVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIEA
CIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPQLLLSVMPQLEFKLKSNDGEERLA
VVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKDL
TEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMMG
LAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLETE
ERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLMT
IAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADVCVREIARKLANPK
QPTNPFLEMVKFLLERIAPVHIDSEAISALVKLMNKSIEGTADDEEEGVSPDSAIRSGLE
LLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKIETDLPQIRSTLI
PILHQKAKRGTPHQAKQAVHCIHAIFSNKEVQLAQIFEPLSRSLNADVPEQLITPLVSLG
HISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIKL
LVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLAQ
EPCYHEIITPEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDPV
KERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDV
DQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDV
ALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPTGVL
GTVNKPLSATGRKPYVRSAGTETGSNINANSELSPSAGSRSREQSSEASETGVSENEENP
VRIISVTPVKNIDTVKNKEINSDQSTQGNISSDRGKKRIVTAAGAENIQKPDEKVDESGP
PAPSKPRRGRRPKSESQGNATKNDDLNKPVSKGRKRAAGSQESLEAGNAKAPKLQDGAKK
AVPAERQIDLQR
NT seq 3999 nt   +upstreamnt  +downstreamnt
atggacttcacgcagccgaagcctgccactgccctctgtggcgtcgtgagtgcggacggg
aagatcgcttaccctccgggagtaaaagagatcaccgacaagatcaccaccgatgaaatg
atcaaacgtctgaagatggtagtgaaaacttttatggatatggatcaggattcagaagat
gaaaagcaacagtatctcccactagccttgcatctcgcatctgaattctttctcaggaac
cctaataaagatgtgcgccttctcgtagcatgttgtttggctgatatatttcgaatctat
gccccagaagctccatatacttcccatgataaacttaaggacatatttctctttattacc
agacagttaaaaggtttggaggatacaaagagtccacagtttaatagatatttttattta
ttagagaatttagcttgggttaaatcatataacatctgctttgagttggaagattgcaat
gaaatttttattcagctttttagaactctcttctcggtaatcaacaatagccacaatacg
aaagtacaaatgcacatgttagacttgatgagttctatcatcatggaaggtgatggagtt
actcaagaattattggattccattcttatcaacctcatccctgcacacaagaacttaaat
aaacagtccttcgaccttgcaaaagtcctactgaaaaggacagtccagactattgaagca
tgtattgccaattttttcaatcaagtcctggtgctgggcagatcatcagtcagcgacctg
tctgaacacgtatttgatctgattcaggaactttttgctatcgatcctcagttactgtta
tctgtcatgccacagcttgaattcaaactgaagagcaacgatggtgaagaacgcctagct
gtggttcgactcctcgcaaaattgttcggctctaaagattcagatttagcaacacagaat
cggcctctctggcagtgctttcttgggcgatttaatgacattcatgttcctgtgaggtta
gaaagtgtgaagtttgccagccactgtttgatgaatcacccagacttagcgaaggatctg
acagaatatttgaaagttaggtcacatgatccagaagaagccattcgtcatgatgttatt
gttactataataacagctgccaaaagagaccttgccttagtaaatgatcagttgcttggc
tttgtcagggaaaggacactggataaacggtggcgagtaagaaaagaagccatgatgggt
ctggctcagctctataagaaatactgtcttcatggggaagcaggaaaggaagccgcggag
aaagtcagctggataaaggacaagctgctgcatatctactatcagaacagcattgatgac
aaactattggtagagaaaatctttgctcagtatcttgttccccacaacctggaaacagaa
gagagaatgaaatgcttatattatttatatgctagcttggatccaaatgctgtaaaagct
ctcaatgaaatgtggaaatgtcagaacatgcttcgaagtcatgtgcgtgaactattggac
ttacacaagcagcctacatcagaagcgaactgttctgccatgtttgggaaactgatgacc
atagcaaagaatttgcctgaccctggaaaagcacaagattttgtaaagaaatttaaccag
gttcttggtgatgatgagaaactgaggtctcagttggaattattaatcagcccaacctgt
tcatgcaagcaggctgacgtttgtgtgagggaaatagctcggaaacttgcaaatcctaag
cagccaaccaacccttttctagagatggtcaaatttcttttggaaagaattgctcctgtg
cacatcgattcagaagccataagtgcactggtaaaactgatgaataagtcaatcgaaggg
acggccgatgatgaagaggagggtgtcagtccagactcagccatccgctcaggacttgag
cttcttaaggttctgtctttcacacatcctacctcgttccactctgcagagacatatgag
tccttgttacagtgcctaagaatggaggatgacaaggtagcagaagctgcaatacaaatt
tttagaaacacaggccacaaaatagaaactgaccttccccagatacggtcaaccttgatc
cccattttacatcagaaagccaagcggggcactccacaccaagcaaagcaggctgttcac
tgcatccatgccatcttctcaaacaaggaggtccagctggcacagatttttgagccactc
agtaggagtctgaatgctgatgtaccagagcaacttataactccattagtttcactgggc
cacatttccatgttagcaccagatcagtttgcctccccgatgaaatctgtagtggcaaac
tttattgttaaagaccttctaatgaacgacaggtcaacaggtgagaagaatggaaaatta
tggtctccagatgaggaagtttctcctgaagttctagcaaaggtacaggcaattaaactt
ctggtaaggtggctgttgggtatgaaaaacaaccagtctaaatctgccaactcaactctt
cggttattatcagccatgctggttagtgagggcgacctgacagagcaaaagaggatcagt
aaatctgatatgtctcgcttgcgattagctgctggtagtgccataatgaagcttgctcag
gaaccttgctaccatgaaattattaccccagaacagtttcagctctgtgcactggttatt
aatgatgagtgctaccaagtaaggcagatatttgcccagaagcttcataaggcacttgtg
aagttgcttctcccactggagtatatggccatctttgctttgtgtgccaaagaccctgtg
aaagaaaggagagcacacgctcggcagtgtttgttaaagaacatcagcatccgcagggag
tacatcaaacagaaccccatggccactgagaaattattgtcactgctgcctgaatatgtg
gttccatacatgattcacctcctagcccatgatcctgatttcacacggtcacaagatgtt
gatcaacttcgtgatataaaagagtgcctgtggtttatgcttgaagtcttaatgacaaag
aatgaaaacaacagccatgcattcatgaaaaagatggcagagaatatcaagctaaccaga
gacgcccagtctcccgatgaatccaagacaaatgaaaaactttatacggtttgtgacgtg
gctctgtgtgttataaatagtaaaagtgctttgtgcaatgcagactcaccaaaggaccca
gtcctcccaatgaagttctttacacagcctgaaaaggacttctgtaatgacaaaagctat
atttcagaagagacaagagttcttctgttaacaggaaagccaaagcctactggagtatta
ggtacagtgaacaagcctttatcagcaacgggaaggaagccttatgttagaagcgccggc
acagagactggaagcaatattaacgccaattcagagctgagtccttcagccggaagtcgt
tcaagggaacagagttcagaggcatcagaaactggagttagtgaaaatgaggagaatcct
gtgagaataatttctgtcacacctgtaaagaatattgatactgtaaagaataaggaaatt
aattctgatcagtctacccaaggcaacatcagcagtgacagaggaaagaaaagaattgta
acagcagctggtgcagagaatatccaaaagccagacgagaaagtagatgagtcaggaccg
cctgccccttccaaaccccggagaggacgtcgccccaaatctgaatctcagggcaatgca
accaaaaacgatgatctaaataaacctgttagcaagggaaggaaaagagctgcaggcagc
caggagagtctggaggcagggaatgccaaagcgcccaagctacaagatggagccaaaaag
gcagttccagcagagagacaaattgatttacaaaggtaa

DBGET integrated database retrieval system