KEGG   Mus musculus (mouse): 71529
Entry
71529             CDS       T01002                                 

Gene name
Kazn, 2310007B04Rik, 9030409G11Rik, AI256607, AI666764, AW061099, Kaz, Kazrin
Definition
(RefSeq) kazrin, periplakin interacting protein
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: SAM_2 SAM_1 DUF148
Other DBs
NCBI-GeneID: 71529
NCBI-ProteinID: NP_653114
MGI: 1918779
Ensembl: ENSMUSG00000040606
Vega: OTTMUSG00000010182
UniProt: Q69ZS8 Q8BJ43
Position
4; 4 D3- E1
AA seq 779 aa
MMEDNKQLALRIDGAVQSASQEVTNLRAELTATNRRLAELSGGGGGPGSGPGAATSASAA
AVTVADSAVATMENHQHGAQVLLREEVVQLQEEVHLLRQMKEMLAKDLEESQGGKCSEVL
SATELRVQLVQKEQELARAKEALQAMKADRKRLKGEKTDLVSQMQQLYATLESREEQLRD
FIRNYEQHRKESEDAVKALAKEKDLLEREKWELRRQAKEATDHAAALRSQLDLKDNRMKE
LEAELAMAKQSLATLTKDVPKRHSLAMPGETVLNGNQEWVVQADLPLTAAIRQSQQTLYH
SHPPHPADRQVRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSLCNGDSPGPV
QKSLHNPIVQSLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLFDDSDSQCSPT
RHSLSLSEGEEQMDRLQHVELVRTTPMSHWKAGTVQAWLEVVMAMPMYVKACAENVKSGK
VLLSLSDEDLELGLGVCSSLHRRKLRLAIEDYRDAEAGRSLSKAADLDHHWVAKAWLNDI
GLSQYSQAFQNHLVDGRMLNSLMKRDLEKHLNVSKKFHQVSILLGIELLYQVNFSREALQ
ERRARCETQNTDPVVWTNQRVLKWVRDIDLKEYADNLTNSGVHGAVLVLEPTFNAEAMAT
ALGIPSGKHILRRHLAEEMSTIFHPSNSTGIRESERFGTPPGRASSITRAGREDSGGNSK
HRAGRLPLGKIGRGFSSKEPDFHDDYGSLENEDCGDEDLQGRPEQCRLEGYGSLEVTNV
NT seq 2340 nt   +upstreamnt  +downstreamnt
atgatggaagacaataagcagctcgcgctccgcatcgatggggcggtccagtcggccagc
caggaggtgaccaacctgcgagccgaactcacggccaccaaccggagactggcggaattg
agcggcggaggcggcggccccggctcgggcccgggagctgcgaccagcgcctcggcagca
gcggtgacggtggctgactcggcagtggcgaccatggagaaccatcagcacggagctcaa
gtgctcctgcgggaggaagtggtccagcttcaagaggaagtgcaccttctccggcagatg
aaggaaatgctggcgaaggacctggaggagtcacagggcggcaagtgctctgaggtcctc
tcagccactgagctccgggtgcagctggtacagaaggagcaggaactggccagagccaaa
gaagccttgcaagccatgaaagctgaccggaagcgcttaaagggcgagaagactgacctg
gtgagccagatgcagcagctgtacgccacgctggagagccgcgaggagcagttgcgagac
ttcatccgcaactatgagcagcaccgcaaggagagtgaagacgcagtcaaagcactggcc
aaggagaaggacctgctggagcgagagaagtgggagcttcgacggcaggccaaggaagcc
acagaccatgctgcggccctgcgctcccagctggacctcaaggacaaccgcatgaaggag
ctggaggcggagctcgccatggccaagcagtccttagccactctgaccaaggatgtcccc
aagaggcattccctcgccatgcccggtgagacggtgctcaatggcaaccaggaatgggtg
gtgcaggctgacctcccactgactgctgccatccggcaaagccaacagactctctaccac
tcacaccctccccaccctgcagaccggcaagtcagggtgagcccctgccactcaagacag
ccctccgtcatctctgatgcttctgctgctgaaggtgaccggtcatctacaccaagcgac
atcaactccccaagacaccggacacactccctctgcaacggcgacagtcccggcccagtt
cagaagagcctacacaaccctattgtacagtcactagaggatcttgaagaccaaaaacgg
aaaaagaagaaggagaagatgggattcggctccatctctcgagtcttcgccagagggaag
caacggaagtccctcgacccgggcctctttgatgactccgacagccagtgcagccccaca
cgccacagcctcagcctgtctgagggagaggagcagatggaccgtctgcagcacgtggag
ctggtgaggaccacgcccatgtcgcactggaaggctggcacagtgcaggcctggctggag
gtggtgatggccatgcccatgtacgtcaaggcctgtgcagaaaatgtcaagagtgggaag
gtgcttctcagcctgagtgacgaggacctggagttgggcctgggagtgtgcagctccttg
cacaggcgcaagctccgcctggccattgaggactaccgagatgctgaggcaggccgcagc
ctgtccaaagctgccgacctggaccatcactgggtggccaaggcctggctgaatgacatt
ggcctgtcccagtattcccaggccttccagaaccacctggttgatgggaggatgctgaat
tcactgatgaagcgggacctggagaaacacctgaacgtgtccaagaagttccaccaagtt
agcatcttgctgggaattgagctgctgtaccaagtgaacttcagcagggaggctctccag
gagcgcagagcccgctgtgaaacacagaacacagaccctgtggtctggaccaaccagcgg
gtgctcaagtgggtgcgcgatatcgacctgaaggagtatgcagacaacctgaccaatagc
ggtgtccatggtgctgtgctggtcctggagcccacattcaatgccgaggccatggccacc
gccctgggcatccccagcgggaagcacatactcaggagacacctggcagaggagatgagc
accatcttccatccatccaactccacaggcatccgggagtctgagcgctttgggacacca
cctggcagggcctctagcatcaccagagctgggagagaggacagtgggggcaatagcaag
cacagagctggccggctgcccctggggaagataggaaggggcttcagcagcaaagagccc
gatttccatgatgactatggctctctggagaacgaggactgtggggatgaggacctccaa
ggcaggccggaacagtgccgtctggagggatacggcagcttggaggtcaccaatgtgtaa

DBGET integrated database retrieval system