KEGG   Mus musculus (mouse): 71564
Entry
71564             CDS       T01002                                 

Symbol
Izumo4, 9030607L17Rik, AI550407
Name
(RefSeq) IZUMO family member 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: IZUMO
Other DBs
NCBI-GeneID: 71564
NCBI-ProteinID: NP_082105
MGI: 1918814
Ensembl: ENSMUSG00000055862
UniProt: D3Z690
Position
10; 10 C1
AA seq 227 aa
MFGQGRLGQAMALLLFLGMTAALARGCLQCDPNFAEKFSFYRHHVNLKSWWVGDIPVSGM
LLSDWIQNTMKELHLAIPAEITRKKLYQVAEAVYQRMDQLYQGKMYFPGYFPNELRAIFR
EQVRLIQNAIIESRIDCQRHCGIYQYETISCSNCTDSHVICFGYYCKSSAQWESAVQGLL
KYINTWHKQDEKMRTTPAFLSQNIKCLEPQHLVNLTLEKVSECLTQH
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtttgggcaaggcaggctgggccaggccatggccctgctgttgtttctgggcatgaca
gcggcgctggcccggggctgcctgcagtgcgaccccaatttcgcggagaagttctccttc
tatcgtcaccacgtgaacctcaagtcgtggtgggtgggtgacattcctgtgtcggggatg
ctgctctccgattggatccagaacacgatgaaggagctccatctggccattcctgctgag
atcacccggaagaagctatatcaagtagcagaagccgtgtaccagaggatggaccagctg
taccaggggaagatgtacttcccagggtatttccccaatgagctgcgggccatcttccgg
gagcaagtgcgcctcatccagaacgccatcatagagagccgcattgactgtcagcgtcac
tgtggtatctaccagtacgagaccatctcctgcagcaactgcacggactcccacgtcatt
tgctttggctactactgcaagtcatcggcacagtgggagtcagctgtacagggccttctg
aaatacataaacacctggcacaaacaggatgaaaagatgagaaccaccccagccttcctg
tcacaaaacataaagtgtctggaacctcagcatctggtcaacctgaccttggaaaaagtc
tctgagtgtctgacccagcactga

DBGET integrated database retrieval system