KEGG   Mus musculus (house mouse): 71566
Entry
71566             CDS       T01002                                 
Symbol
Clmp, 9030425E11Rik, ACAM, ASP5
Name
(RefSeq) CXADR-like membrane protein
  KO
K06789  adipocyte-specific adhesion molecule
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    71566 (Clmp)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 V-set_CD47 DUF6203 Ig_C17orf99 Syndecan
Other DBs
NCBI-GeneID: 71566
NCBI-ProteinID: NP_598494
MGI: 1918816
Ensembl: ENSMUSG00000032024
UniProt: Q8R373
Position
9:40596975..40696849
AA seq 373 aa
MSLFFLWLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQK
VVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVW
SHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPP
KSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVAGAVTGI
VAGALLIFLLIWLLIRRKSKDRYEEEDRPNEIREDAEAPRARLVKPSSSSSGSRSSRSGS
SSTRSTGNSASRSQRTLSSEAAPQQPGLAPQAYSLIGPEVRGSEPKKVHHTTLTKAETTL
STTPSQSKAFQTV
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtccctcttcttcctctggctagtatcctattatgttggaacgctgggaactcacact
gagatcaagagagtggcagaggaaaaggttaccttgccctgtcaccatcaactggggctt
cccgagaaagacaccctggacattgaatggctgctcaccgataatgaagggaaccaaaaa
gtggttattacgtattccagccgtcatgtctacaataacttgaccgaggagcagaagggc
cgagtggccttcgcttccaacttcctggcaggagatgcttccctgcagattgagcctctg
aaacccagtgatgaaggcagatacacctgcaaggtgaagaattcaggacgctatgtctgg
agccatgtcatcttgaaagtgctagtgagaccatccaagcccaagtgtgagctggaagga
gagccgaccgaaggaagtgacctgacgctgcagtgtgagtctgcctctggaactaagccc
attgtgtattattggcagcgaatccgggagaaggagggagaagatgaacacctgccaccc
aaatccagaattgattacaacaaccctggccgagtgctgctgcagaatctcaccatggcc
tcctctgggctttaccagtgcacagcaggcaacgaggctggaaaggagagctgtgtggta
cgggtgactgtacagtatgtgcagagcattggcatggtggcaggagcagtgacaggcata
gtggcaggagccctgctcattttcctcctgatatggctgctaatacgaaggaaaagcaaa
gacagatacgaggaagaagacagacctaatgaaatccgagaagacgccgaagcgccccga
gcccgccttgtgaagcctagctcctcttcctcaggctcccggagctcacgctctggctcc
tcctccacccgctccaccgggaacagtgcctccagaagccagcggacgctgtcgagtgaa
gcagcgccgcagcagcccgggctagccccgcaggcatacagcctcataggaccggaagtg
agaggttctgaaccaaagaaagtccaccatacgaccctgaccaaagcagaaaccacactc
agcacaacgcccagccagagcaaagccttccaaactgtctga

DBGET integrated database retrieval system