KEGG   Mus musculus (house mouse): 71597
Entry
71597             CDS       T01002                                 
Symbol
Isx, 9130012O13Rik, Pix-1
Name
(RefSeq) intestine specific homeobox
  KO
K24898  intestine-specific homeobox
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    71597 (Isx)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    71597 (Isx)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 71597
NCBI-ProteinID: NP_082113
MGI: 1918847
Ensembl: ENSMUSG00000031621
UniProt: A1A546 B1Q2M1
Position
8:75599802..75620134
AA seq 240 aa
MAGPTIHRDMEKSSGYCEAPENLGLSFSIEAILKKPTERRSLPRPQSICKEDSRQTTIPG
SKLERPPQDQPQEEKKNKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINLPEA
RVQIWFQNQRAKWRKQEKSGNLSAPQQPGEAGLALPSNMDVSGPVLTPTAMTTLVPPTEC
CLLSQTQLPSSWFPTQIPLVPWHPWDLQPLPGPLTQHPCVPTFMFPPLHPKWGSICATST
NT seq 723 nt   +upstreamnt  +downstreamnt
atggcaggccctacgatccacagggacatggagaagagttcaggatactgtgaagcccca
gagaatctgggcttgtccttctccattgaggcaatcctgaagaaacccacagaaagaaga
agtttgcccagaccacaaagcatttgtaaagaggactccaggcagacaactatcccaggt
tccaagctggagaggcccccacaggatcagccccaagaagagaaaaagaacaagcggaga
gttcgcactaccttcaccacagagcagctacaggagctggagaagctcttccacttcacc
cattaccctgacatccatgtccgttcccaattggcttccaggattaacctgcctgaagct
cgagtacagatctggttccagaatcagagagccaagtggaggaagcaggagaagagtggg
aacctcagtgccccacagcagcctggtgaggccggcttggccctgccctcaaacatggac
gtgtctggtcctgtgctgacacccactgctatgactacattggtacctcccacagaatgc
tgcctactctctcagactcagctcccttcaagctggttccctacacagattccccttgtc
ccatggcacccatgggacctacagcccctgcctggccctctcacccagcatccttgtgtc
cctaccttcatgttcccacccctacaccccaagtggggcagcatctgtgcaacttcaaca
tag

DBGET integrated database retrieval system