KEGG   Mus musculus (mouse): 71607Help
Entry
71607             CDS       T01002                                 

Gene name
Snx20, 9130017C17Rik
Definition
(RefSeq) sorting nexin 20
  KO
K17931  sorting nexin-20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    71607 (Snx20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX TPR_12 Flp_N
Motif
Other DBs
NCBI-GeneID: 71607
NCBI-ProteinID: NP_082116
MGI: 1918857
Ensembl: ENSMUSG00000031662
Vega: OTTMUSG00000061527
UniProt: Q9D2Y5 A0A0R4J0D0
Position
8; 8 C3
AA seq 313 aa AA seqDB search
MASPEHPGSPGWRGPINQCRTRTRQEVLPPGPDLPCPGPEEAQDGPSSNSSMTTRELQEH
WQKEKSRWKHVRLLFEIASARIEERKVSKFVMYQVVVIQTGSFDSDKAVVERRYSDFERL
QKALLKRFGPELEDVAFPRKRLTGNLSAETICERRRELREYLRLLYAVRAVRRSREFLDF
LTRPELREAFGCLRAGQYARALELLGRALPLQEKLTAHCPSAAVPALCAALVCLRDLERP
AEAFAVGERALRCLRTRENHRYYAPLLDAMVRLAYALGKDFAALQSRLDENQLRRPTHRD
ATLKELTVREYLS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtccagagcatcctgggagccctggctggagaggacccataaaccaatgcaga
acaaggaccagacaggaagtattgcccccaggcccagacctcccatgtccaggaccagaa
gaagcccaagatggccccagctctaactccagcatgaccacaagggaactccaggaacac
tggcagaaggagaagagccgctggaaacatgtcaggctgctctttgagatcgcctcagcc
cgcatagaggagaggaaagtctccaagtttgtgatgtaccaagtcgtggtcatccagacc
gggagcttcgacagcgacaaggcggtggtggaacggcgctactcggacttcgagaggctg
cagaaggccctcctcaagcgcttcgggccggagctggaggacgtggcgttcccgcggaag
cgcctgaccgggaacctgtcggccgagaccatctgcgagcggcgccgggagctgcgcgag
tacctgcggctgctttacgccgtgcgcgccgtgcgccgctcgcgcgagttcctcgacttc
ctcacgcggcccgagctgcgcgaggccttcggctgcctgcgcgccggccagtacgcgcgc
gcgctcgagctgctgggccgcgcgctgccgctgcaggagaagctgacggcgcactgcccg
agcgccgccgtgcccgcgctttgcgccgcgctcgtctgcttgcgcgacctcgagcggccg
gccgaggccttcgcagtcggcgagcgcgcgctgcgatgcctgcggacgcgcgagaaccac
cgctactacgcgccactgctggacgccatggtgcgcctggcctacgcgctgggcaaggac
ttcgcggcgctgcagagccgcctggacgagaaccagctccggaggcccacgcacagggac
gccaccctgaaggagctcacggtgcgggagtatctgtcctga

DBGET integrated database retrieval system