KEGG   Mus musculus (mouse): 71609Help
Entry
71609             CDS       T01002                                 

Gene name
Tradd, 9130005N23Rik, AA930854
Definition
(RefSeq) TNFRSF1A-associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    71609 (Tradd)
   04064 NF-kappa B signaling pathway
    71609 (Tradd)
   04668 TNF signaling pathway
    71609 (Tradd)
   04071 Sphingolipid signaling pathway
    71609 (Tradd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    71609 (Tradd)
   04217 Necroptosis
    71609 (Tradd)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    71609 (Tradd)
   04657 IL-17 signaling pathway
    71609 (Tradd)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    71609 (Tradd)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    71609 (Tradd)
  09167 Infectious diseases
   05152 Tuberculosis
    71609 (Tradd)
   05160 Hepatitis C
    71609 (Tradd)
   05163 Human cytomegalovirus infection
    71609 (Tradd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    71609 (Tradd)
   05169 Epstein-Barr virus infection
    71609 (Tradd)
   05165 Human papillomavirus infection
    71609 (Tradd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRADD_N Death
Motif
Other DBs
NCBI-GeneID: 71609
NCBI-ProteinID: NP_001028333
MGI: 109200
Ensembl: ENSMUSG00000031887
Vega: OTTMUSG00000027472
UniProt: Q3U0V2 B2RRZ7
Position
8 D3; 8 53.04 cM
AA seq 310 aa AA seqDB search
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQ
ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGS
KFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPDGGLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagccggtcagaatggccacgaggagtgggtgggcagtgcatacctgtttttggag
tctgcggtagacaaggtgatcctgtctgaagcctacacggatcccaagaagaaggtggca
atatacaaggctctgcagactgcactgtcagagagtggggacagctctgacgtactgcag
atactcaagatccactgcagcgaccctcagctcatcgtccagttgcggttctgcgggcgc
gtgctgtgcggccgcttcctccaagcctaccgcgagggggcgctgcgcaccgcgctgcag
aggtgcatggccccggcgcttgcccaggaagcgctgcggttgcagctggagttgcgtgca
ggtgcggagcagctggacagttggctgactgatgaagagcgctgtttgaattacatctta
gcccagaagcccgaccggctcagggacgaggaactcgcggagctggaggatgagctctgc
aaactgacgtgtgactgcactggccagggtggagccatacaggtagcttctgcaggttcg
aagttcccggtttcctctccgaccgaggagaaaccactgccggccgcctgccagactttt
ctgttccacgggcagctcgtagtgaaccggccactgactcttcaagaccagcagacgttt
gcgcgctcggtgggtctcaagtggcgcagggtggggcgctcgctgcagcgtaactgtcgg
gcactgagagatcctgccctcgactcgctggcctacgagtatgagcgtgatgggctatac
gagcaggccttccagctgctgcgccgtttcatgcaagccgagggccgccgtgccacactg
cagcgcctggtggaggcgctggaggagaacgaactcactagtctagcagaggatctgttg
ggccaggcggagccggatggcggcctggcctaa

DBGET integrated database retrieval system