KEGG   Mus musculus (house mouse): 71648
Entry
71648             CDS       T01002                                 
Symbol
Optn, 4930441O07Rik, FIP2, HYPL, NRP
Name
(RefSeq) optineurin
  KO
K19946  optineurin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04137  Mitophagy - animal
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    71648 (Optn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    71648 (Optn)
   05022 Pathways of neurodegeneration - multiple diseases
    71648 (Optn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71648 (Optn)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    71648 (Optn)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    71648 (Optn)
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    71648 (Optn)
  Xenophagy
   Cargo receptors
    71648 (Optn)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 CMD UCH
Other DBs
NCBI-GeneID: 71648
NCBI-ProteinID: NP_862896
MGI: 1918898
Ensembl: ENSMUSG00000026672
UniProt: Q8K3K8
Structure
Position
2:complement(5023902..5069210)
AA seq 584 aa
MSHQPLSCLTEKGDSPCETPGNGPSNMVHPSLDTFTPEELLQQMKELLVENHQLKEAMKL
NNQAMKGRFEELSAWTEKQKEERLLFEMQSKEVKERLKALTHENERLKEELGKFKEKSEK
PLEDLTGGYRYPRALEEEVEKLKTQVEQEVEHLKIQVMRLRAEKADLLGIVSELQLKLNS
GGSSEDSFVEIRMTEGETEGAMKEMKNCPTPTRTDPISLSNCTEDARSCAEFEELTVSQL
LLCLREGNQKVERLEVALREAKERISDFEKKANGHSSTEKQTARRADREKEDKGQESVGS
EVETLSIQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSELNEKQELVYS
NKKLELQVESMRSEIKMEQAKTEEEKSRLATLQATHNKLLQEHNKALKTIEELTKQQAEK
VDKMLLQELSEKLELAEQALASKQLQMDEMKQTLAKQEEDLETMAVLRAQMEVYCSDFHA
ERAAREKIHEEKEQLALQLAILLKENNDIEEGGSRQSLMEMQCRHGARTSDSDQQTYLFQ
RGAEDRSWQHGQQPRSIPIHSCPKCGEVLPDIDTLQIHVMDCII
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgtcccatcaacctctgagctgcctgactgagaagggggacagcccttgtgagacccca
ggaaatggaccctccaatatggttcaccccagcctggacacattcacccctgaggagctg
ctgcagcaaatgaaggaactcctggttgagaaccaccagctgaaagaagccatgaagcta
aataatcaagctatgaaagggcgatttgaggagctgtccgcctggacagagaagcagaag
gaagagcgcctgttgtttgagatgcaaagcaaagaggttaaggagcgccttaaggccctg
actcatgaaaatgagaggctgaaggaagagcttggaaaattcaaagagaaatcagaaaag
ccattggaagacctcacaggtggctacaggtatcccagagccttggaggaggaagtggag
aagctgaagacccaggtggagcaggaagtggagcatctgaagatccaggtgatgcgcctt
cgggctgaaaaggcagacctgctgggcatcgtctcagaactgcagctcaaactcaactcc
ggcggctcctcggaagactccttcgttgagatcaggatgaccgaaggagagactgaaggg
gcaatgaaggagatgaagaactgccctacacccacaagaacagaccccatcagcttgagc
aactgtacagaggatgccaggagttgtgcggagtttgaagaactgactgtgagccagctt
ctgctttgcctaagggaaggaaaccaaaaggtggagagacttgaagtcgccctcagagaa
gccaaagaaagaatttcagattttgaaaagaaagcaaatggccattcttctactgagaag
cagacagcgaggagagcagacagagagaaggaggacaaaggccaagagagtgttggaagc
gaagtggaaacactgagcattcaagtgacctctctgtttaaggagcttcaagaggcacac
acaaaactcagtgaggctgagctgatgaagaagagacttcaagaaaagtgtcaggctctg
gagaggaagaactctgcaacaccatcagagctgaatgaaaagcaagagctcgtttacagt
aacaagaagttagagctgcaggtggagagcatgcgctccgaaatcaagatggagcaggcc
aagacagaggaggagaagtccaggttagccactctgcaggcaactcacaacaagctcctt
caagaacataataaggcactgaaaacaattgaagaactaaccaagcaacaggcagaaaag
gtggacaagatgttgctgcaggagctcagcgagaagctggagctggcagagcaggctctg
gcatccaaacagctccagatggatgagatgaagcagacgctcgctaagcaggaggaagac
ctggagaccatggccgtcctcagggctcagatggaggtgtactgctcagattttcacgct
gagagagcagcaagagagaagattcatgaagaaaaggagcagctggccttgcagctcgcg
attttgctgaaagagaacaatgacattgaagagggaggcagtagacagtccctgatggaa
atgcagtgccgacacggggcaagaaccagtgactctgaccagcagacttacctgtttcaa
agaggagccgaggacaggagctggcagcacgggcagcagcctcgcagtattccgattcac
tcctgccccaagtgcggggaggtcctgccggacatcgacacgcttcagatccatgtgatg
gactgcatcatttga

DBGET integrated database retrieval system