KEGG   Mus musculus (mouse): 71653
Entry
71653             CDS       T01002                                 

Gene name
Shtn1, 4930506M07Rik, Shootin1, mKIAA1598
Definition
(RefSeq) shootin 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Atg14 Spc7
Other DBs
NCBI-GeneID: 71653
NCBI-ProteinID: NP_001107784
MGI: 1918903
Ensembl: ENSMUSG00000041362
UniProt: Q8K2Q9
Position
19; 19 D2-D3
AA seq 631 aa
MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISH
MVIEEVNFMQNHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINID
DDDPATDTDAAAETCVSVQCQKQIKELRDQIVSVQEEKKVLAIELENLKSKLGEVMEEVN
KVKQEKAVLNSEVLEQRKVLEKCNRVSMLAVEEYEELQVNLELEKDLRKKAESFAQEMFI
EQNKLKRQSHLLLQSSLPDQQLLKALDENAKLIQQLEEERIQHQKKVKELEERLENEALH
KEIHNLRQQLELLEDDKRELEQKYQSSEEKARNLKHSVDELQKRVNQSENSVPPPPPPPP
PLPPPPPNPIRSLMSMIRKRSHPSGNSAKKEKTTQPETAEEVTDLKRQAVEEMMDRIKKG
VHLRPVNQTARPKAKPDSLKGSESAVDELKGILGTLNKSTSSRSLKSLGPENSETELERI
LRRRKLTAEADSSSPTGILATSESKSMPVLGSVSSVTKSALNKKTLEAEFNNPCPLTPEP
GEGPRKLEGCTNPKVTFQPPSKGGYRRKCVGSENQAEPVVVLDPVSTHEPQTKDQAAEKD
PTQFEEEGGETQPEYKEDSGGKTGETDSSNC
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaacagctcggacgaggagaagcagctgcagctcatcaccagcttgaaggagcaagcc
attggcgaatatgaagaccttcgagcagagaaccagaaaacaaaggagaagtgtgacaaa
attaggcaagaacgagatgaagctgttaaaaaactggaagagtttcagaaaatttcacat
atggttatagaggaggtgaatttcatgcagaaccatcttgaaatagagaagacatgtcga
gagagcgctgaagccttggcgacaaagctaaataaagaaaataaaacactgaaaagaatc
agcatgctatacatggccaaactggggccagacgtaattacagaggagataaacattgat
gatgatgacccagccaccgacacagatgctgcggctgagacctgtgtgtctgttcagtgt
cagaagcaaatcaaagaacttcgagatcaaattgtgtctgttcaggaagaaaagaaggtg
ttagccatcgagctggaaaacctcaagagcaaactcggggaggtgatggaggaggtaaat
aaagttaagcaagaaaaagctgttttaaattcagaagtccttgagcagaggaaagtctta
gaaaaatgcaacagagtgtccatgttggctgttgaagagtatgaggaactgcaagtgaac
ctggaactggagaaggaccttcgcaagaaagcagagtcttttgcacaagagatgttcatt
gaacaaaacaaactgaagagacaaagccaccttctgctgcagagctcccttcctgaccag
cagcttttgaaagctttagacgaaaacgcaaaacttatccagcagcttgaagaagagagg
atccagcatcagaaaaaggtcaaagagctggaggagcggctggagaatgaagcacttcac
aaagagatccataacctcagacaacagctggagcttctggaagacgacaagagggagcta
gagcagaaataccagagctcggaggagaaggcccggaacctgaagcattcagtggatgaa
cttcagaagcgagtgaaccagtctgagaattcggtacctcccccgcctcctcctcctcca
cctctcccccctccacctcccaatccaatccggtccctcatgtctatgatccggaagcga
tctcaccccagtggcaatagtgctaagaaagaaaagacaactcagccagagacagctgag
gaagtcacagacctgaagaggcaagcagtggaagagatgatggacagaattaagaaggga
gttcatcttagaccggttaaccagacagccagacccaaggcaaagccagactctctcaag
ggctcagaaagtgcggtggatgagctgaagggaatcctggggacacttaacaaatccact
agttcgagaagcttaaaatcccttggccctgagaacagtgaaactgagttagagaggatt
ttacgtcgcagaaagctgacggcagaagcagatagcagtagtcctaccgggatattagcc
acctcagagtccaagtccatgccagtgttgggttctgtatccagtgtaacaaaatcagcc
ttgaacaagaaaactctggaggcagaattcaacaacccgtgtcccctaacacctgagcca
ggtgaagggccccgtaaattggaaggatgcacgaatcccaaggttacctttcagcctccc
agtaaaggtggatacaggagaaaatgtgtgggcagtgaaaaccaagctgagccagttgta
gtattagatcctgtttccacacacgaaccccaaaccaaagaccaggctgctgaaaaagac
ccaactcaattcgaggaggagggaggtgaaacccaaccagaatacaaagaagacagcggt
gggaaaacaggagagacggacagttccaactgctga

DBGET integrated database retrieval system