KEGG   Mus musculus (mouse): 71664Help
Entry
71664             CDS       T01002                                 

Gene name
Mettl7b, 0610006F02Rik, AI266817
Definition
(RefSeq) methyltransferase like 7B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_23 Methyltransf_25 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_8 TehB CheR MetW Methyltransf_24 Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 71664
NCBI-ProteinID: NP_082129
MGI: 1918914
Ensembl: ENSMUSG00000025347
UniProt: Q9DD20
Position
10; 10 D3
AA seq 244 aa AA seqDB search
MDALVLFLQLLVLLLTLPLHLLALLGCWQPICKTYFPYFMAMLTARSYKKMESKKRELFS
QIKDLKGTSGNVALLELGCGTGANFQFYPQGCKVTCVDPNPNFEKFLTKSMAENRHLQYE
RFIVAYGENMKQLADSSMDVVVCTLVLCSVQSPRKVLQEVQRVLRPGGLLFFWEHVAEPQ
GSRAFLWQRVLEPTWKHIGDGCHLTRETWKDIERAQFSEVQLEWQPPPFRWLPVGPHIMG
KAVK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggatgccctggttctatttctgcagctgctggtgctgctcctgactctacctctacac
ctactggctctgctgggctgctggcagcctatatgcaaaacctacttcccttacttcatg
gccatgctaacagccaggtcctacaaaaagatggaaagcaagaaacgggaactatttagc
cagataaaagatctcaaggggacttccggcaacgtggccctgctggagctgggctgcggc
accggtgccaacttccagttctacccacagggctgcaaggtcacctgtgtggacccaaac
cccaacttcgagaagttcctgacaaagagcatggctgagaacaggcacctccaatatgag
cgcttcattgtggcttacggagagaacatgaaacaactggctgacagctccatggatgtg
gtggtctgtaccctggtgctatgttctgtgcagagccccagaaaggtcctgcaggaagtc
cagagagtcctgaggccgggaggcctactgttcttctgggagcacgtggctgagcctcag
ggaagccgggccttcctgtggcagcgagttttagagcctacctggaaacacatcggagat
ggttgccacctcaccagagagacctggaaagacattgagagggcacagttctccgaagtc
cagctggaatggcagccccctcccttcaggtggttacctgttgggccccacatcatggga
aaagctgtgaaataa

DBGET integrated database retrieval system