KEGG   Mus musculus (mouse): 71667
Entry
71667             CDS       T01002                                 

Gene name
Tmem248, 0610007L01Rik, A930023A16Rik, AW557951, G430067H08Rik
Definition
(RefSeq) transmembrane protein 248
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: TMEM219 Omp28 PH_9
Other DBs
NCBI-GeneID: 71667
NCBI-ProteinID: NP_001074863
MGI: 1918917
Ensembl: ENSMUSG00000053094
Vega: OTTMUSG00000055826
UniProt: Q3TBN1
Position
5; 5 G1.3
AA seq 314 aa
MFSINPLENLKLYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLL
RFNDLDLCVSENETLKHLSNDTTTPESTMTVGQARSSTQPPQSLEESGPINISVAITLTL
DPLKPFGGYSRNVTHLYSTILGHQIGLSGREAHEEINITFTLPAAWNADDCALHGHCEQA
VFTACMTLTAAPGVFPVTVQPPHCIPDTYSNATLWYKIFTTARDANTKYAQDYNPFWCYK
GAIGKVYHALNPKLTVVVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQS
NPEFCPEKVALADA
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttcagtatcaaccccctggagaacctgaagctgtacatcagcagccggccgcccttg
gtggtttttatgatcagtgtcagcgccatggccatcgccttcctcaccctgggctacttc
ttcaagatcaaggagattaagtccccagaaatggctgaggattggaatacttttctgctc
cggtttaatgatttggacttgtgtgtatcagaaaacgagacactgaagcatctctccaac
gataccaccacaccagagagcaccatgaccgtcgggcaggccagatcgtctacccagccg
ccccagtccctggaggagtcaggccccatcaatatttcagtggccattaccttgaccttg
gaccctctcaagccctttggagggtactctcgaaatgttacacacctgtactccaccatc
ctcgggcatcagattggattgtcaggcagggaagcccacgaggagatcaacatcaccttc
accctgcctgctgcctggaacgccgatgactgtgccctccatggccactgtgagcaggcg
gtgttcacagcatgcatgaccctcacagctgcccccggagtcttccccgtcactgttcag
ccacctcactgtatccccgacacatacagcaacgccacgctctggtacaagatcttcaca
actgccagagatgccaacacgaaatatgctcaagactacaatcctttctggtgttataag
ggtgccattgggaaagtctaccatgctttaaatcccaaactcactgttgttgttccagat
gacgaccgctcattaataaacctgcatctcatgcacaccagttacttccttttcgtgatg
gtgataacgatgttctgctatgcagtcatcaaaggcagacccagcaaactgcggcagagc
aatcctgaattttgccctgagaaggtggctctggctgacgcctaa

DBGET integrated database retrieval system