KEGG   Mus musculus (mouse): 71670Help
Entry
71670             CDS       T01002                                 

Gene name
Acy3, 0610006H10Rik, AA3, AAIII, AW107362, Acy-3, HCBP1
Definition
(RefSeq) aspartoacylase (aminoacylase) 3
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    71670 (Acy3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     71670 (Acy3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AstE_AspA
Motif
Other DBs
NCBI-GeneID: 71670
NCBI-ProteinID: NP_001289408
MGI: 1918920
Ensembl: ENSMUSG00000024866
UniProt: Q91XE4
Structure
PDB: 

Position
19; 19 A
AA seq 318 aa AA seqDB search
MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPSFSAMPVLANPAATAA
CCRYLDRDLNRSCTLTFLGSTATPDDPYEVKRARELNQLLGPKGTGQAFDFTLDLHNTTA
NTGVCLISESNISFNLHLCHYLQRQNPGMPCRLFLYEPAGTETFSVESISKNGICLEMGP
QPQGVLRADLFSRMRALVASILDFIELFNQGMDLPAFEMDIYRNLGSVDFPRTADGDLAG
TVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSIVYPVFINEAAYYEKHVAFLKSEKI
RVTVPALLRLTPRSTQTP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctacctgggtcccgggagcccctgctccgtgtggctgtgactggaggcacc
cacgggaatgagatgtgtggtgtctacctggcccggtactggctacagaacccaggggag
ctgcagagacccagcttctcagccatgccggttctggccaacccagcagccacagctgcc
tgttgccgttacctggaccgtgatctcaaccgctcctgcaccctcaccttccttggttcc
accgctacccctgatgacccctatgaagtgaaaagagcccgagagttgaaccagctgctg
ggtcccaagggcacaggccaggcttttgactttaccctagacctgcacaacaccacagca
aacactggagtctgcctcatctctgaatccaacatctccttcaacttgcacctgtgccac
tacctacagcggcagaacccggggatgccctgccgcctctttctgtatgagccagctggg
acggagaccttcagcgtggaatctatatccaagaatggaatctgtctggagatgggccca
cagcctcagggcgtgctgcgggccgacctgttctcccggatgcgagctctggtggcatcc
attctggacttcatcgagctcttcaaccaaggcatggacttacccgcctttgagatggat
atctacaggaacttgggcagtgtggacttcccacgcactgcagatggtgacctggctggc
actgtgcaccctcaactgcaggaccatgactttgagccactgaggcctggtgaacccatc
ttcaagcttttcagcggagaagacgtactgtatgagggggactccattgtgtaccctgtg
ttcattaatgaggctgcctattatgagaagcacgtggcattcctgaagtctgagaagatc
agggtcacagtgcctgccctgctgaggttgaccccccgctccacccagactccctaa

DBGET integrated database retrieval system