KEGG   Mus musculus (mouse): 71673
Entry
71673             CDS       T01002                                 

Symbol
Rnf215, 0610009J22Rik, AW557025, C77903
Name
(RefSeq) ring finger protein 215
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-RING_2 zf-RING_11 zf-C3HC4_2 zf-C3HC4 zf-rbx1 zf-RING_5 zf-RING_UBOX zf-C3HC4_3 ZNRF_3_ecto zf-C3H2C3 Prok-RING_4
Other DBs
NCBI-GeneID: 71673
NCBI-ProteinID: NP_082135
MGI: 1918923
Ensembl: ENSMUSG00000003581
Vega: OTTMUSG00000005052
UniProt: Q5SPX3
Position
11; 11 A1
AA seq 379 aa
MGSADRPALRSPSLPPPPPSPPSPLLLLLPLLPLWLGLMGPGAAADGSEPATGEGRGGAR
SVRVDVKLPRQDALVLEGVRIGPEDGPEPLLGGRLLLMDVVDAEQEIPVDGWIAVAYVGK
EQVAQFHQENQGSSQKAYPKALVQQMRRALFLGASALLLLILNHSVVRELDVSQLLLRPV
IVLHYSSNVTKLLEALLQRTQATAEISSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLV
CLGGAQAQEQKPLQQLWNAILLVAMLLCTGLVVQAQRQASRQNQQEPGGQEDLFKRRVVR
RLASLKTRRCRLSRAAHSLPEPGTETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLML
QQTCPLCKFNVLGNHYSDD
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgggctctgccgatcgccccgcgctgaggtcgccttcgttgccgccccctcccccatcg
ccgccgtcgccgctgctgctactgctgcctctgctgcctttgtggctgggcctgatgggc
ccgggagcggcggcggacggcagcgagccggcgaccggggagggacggggcggagcccgc
tcagtgcgagtggatgtgaaactgccgcggcaggacgccttggttttggagggcgtcaga
atcggtccggaagacggtccggaacctctgctgggtggccgcctgctgctgatggatgtc
gtggatgctgagcaagagatacccgtagatggctggattgcagtggcatatgtgggcaaa
gagcaggtcgcccagttccaccaagagaatcaaggcagtagccagaaggcatatcccaag
gctctggtccagcagatgcgtcgagcccttttcctgggagcctctgccctgcttctcctc
atcttaaaccacagtgtggtccgagagctggatgtatcccagcttctgctgaggccagtg
attgttctccattactcctccaatgtcaccaagctgttggaggcccttctgcagaggacc
caggctactgctgagatcagcagtggagagtccctttcagccaacatcgagtggaagctg
acattgtggaccacctgtggtctctccaaggatggctacggaggctggcaggacttggtg
tgcctgggaggtgctcaggcccaggagcagaagcccctgcagcagctatggaacgccatc
ttgcttgtggccatgctcctgtgtacaggacttgtggttcaggcccaacggcaggcgtca
agacagaaccagcaggagcctggaggccaggaggatttgttcaaacgccgtgtggttcgg
aggctagcatctctcaagactcggcgctgccggctgagcagggcagcacacagccttcca
gagccgggcactgagacgtgtgctgtgtgtctagattacttctgtaacaagcaatggctc
cgggtactgccctgtaagcatgagttccaccgagactgtgtggacccctggctgatgcta
caacagacctgcccactgtgcaagttcaacgtcctggggaaccactactcagatgactaa

DBGET integrated database retrieval system