KEGG   Mus musculus (mouse): 71675
Entry
71675             CDS       T01002                                 

Symbol
Sanbr, 0610010F05Rik, Kiaa1841, mKIAA1841
Name
(RefSeq) SANT and BTB domain regulator of CSR
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF3342 Myb_DNA-binding
Other DBs
NCBI-GeneID: 71675
NCBI-ProteinID: NP_082136
MGI: 1918925
Ensembl: ENSMUSG00000042208
Vega: OTTMUSG00000005276
UniProt: Q68FF0
Position
11; 11 A3.2
AA seq 718 aa
MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKS
CGSSPVDNQYNPLMATGEGPVETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATT
RNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKEDFICPRDLLISEMKYFAEYL
SMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSLVEQCIQYCHKNMNAIVAAPCNMNCINANLLTRIADLFTHNEIDDLKDKKDKFRSKLF
CKKIERLFDPEYSNPDSRNNAATLYRCCLCKKLLTRETERRIPCIPGKINVDRHGNIIYI
HIRDKTWDVHEYLNSLFEELKSWRDVYWRLWGTVNWLTCSRCYQAFLCIEFSHCQYHSEV
VVYSSTVNSLNTVGTGIYPCCNQKVLRFDPTQLTKGCKVRDHMVVLHDQGENDDSPSCPP
AKILDDLHKHKDVIAVPFLKDAVSDPGVGSCDEKGLEYEILLEPNTPWGSKTGELNAFLS
LKNWTLQLKQQSLFSEEEEYTTGSEVTEDEVGDEEEIAKKQRKKEKPKKFTKPPKKQLSS
PCSQKKEKTLEKSTSRDVSPFVVSMQKNKWDASRSLRFNQDAQREDDQRRMSEITGHLIK
MRLGDLDRVKAKESKEFAGGIYSRLEAQVRASVPVTARQNSSDKNQRSKSRFGQGRPA
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgagtcgtggatatccagaaaacaataattttctgaataataataaccaaatggtattg
gatatgattctttatccattgattggaatccctcagaccatcaactgggaaactgtggca
aggcttgtgcctggattaacgcccaaagagtgtgtgaaaaggtttgatgagctaaagagc
tgtggaagttcacctgttgacaaccagtataaccctttaatggctactggagagggtcct
gttgaaactttagccacttacattaaatcttcacttctggacacacaaggagattttcaa
gagactcctgttgatcaagatacagtttctaaagcaggaagacatagtatagctaccaca
aggaattgctcttcagaaagtgaaaactgtactgctcgtaatgctggagaagagactgga
gaatctgaagggccaaacatggtgatccatgtatgtgatgaagcaaaaagcttgaaagaa
gattttatttgcccacgagatcttttgatatcagaaatgaagtactttgctgaatattta
tccatggatgcgcagcgctgggaagaagtggacatttcagttcattgcgatgttcacatt
ttcaactggctgataaaatatgttaaacggaacactaaggagagtaaagattgtgagatt
cccgctttagagccagggaatgtcatttcaatccttatttcatcagagttcttgaagatg
gattcactagttgaacaatgtattcaatattgccataaaaatatgaatgccatagtagct
gctccatgcaacatgaactgtatcaatgcaaaccttcttacacgcatagctgatctgttc
acacacaatgaaattgatgacttaaaagacaaaaaagataagtttaggagtaaactgttt
tgtaagaagattgaaagactctttgatcctgaatactccaatccagattctagaaacaat
gcagcaacactctatcgatgctgtttgtgtaagaaacttttaaccagagaaacagaaaga
agaattccttgcatccctggaaaaatcaatgtggaccgacatggaaatattatctacatc
cacataagagataaaacctgggatgtacatgaatatttgaatagtctttttgaagaatta
aaatcttggagagatgtttattggcgtttgtggggcacagtcaactggctgacttgttca
aggtgttaccaggcttttctctgtattgagttctcacattgtcagtatcactcagaagtg
gtagtttattctagcacagtaaattcactaaacactgtgggcactggaatttatccctgc
tgtaaccagaaggttcttcgatttgatcctactcagctcacaaagggctgtaaggtgagg
gaccacatggtggttcttcatgatcaaggagaaaatgatgattcgccttcttgcccacct
gctaaaatactggatgatctgcacaagcacaaagacgtcattgctgtgccttttttaaaa
gatgcagttagtgatcctggggttggctcctgtgatgaaaaaggcctggaatatgaaatt
ttactggaaccaaatacaccgtggggctccaaaactggggagctcaatgctttcttgtca
ctgaaaaactggactctgcagttgaaacaacagtcgctgttctcagaagaggaagagtat
accacggggtctgaggtcactgaagatgaagtcggtgatgaagaagaaattgccaagaaa
caaaggaaaaaggagaagccaaagaaatttactaagccgccaaaaaaacaactgtcctca
ccctgttctcaaaagaaagagaagacactggagaagtcaacttctagagatgtgtctcct
tttgttgtgagtatgcagaagaataaatgggatgcctcaagatccttgagattcaaccaa
gatgcacaaagagaagatgatcagcggcggatgtctgaaattacagggcatctaataaaa
atgagattgggtgatctggaccgagtcaaggcaaaggaatcaaaggaatttgcaggaggt
atttattctaggcttgaagcacaagtcagagcctcagtacctgtcactgcccggcagaac
agctcagacaaaaaccaaaggtctaaaagtcgttttggtcaagggcgtcctgcataa

DBGET integrated database retrieval system