KEGG   Mus musculus (mouse): 71678
Entry
71678             CDS       T01002                                 

Symbol
Brox, 0610010K06Rik
Name
(RefSeq) BRO1 domain and CAAX motif containing
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BRO1
Other DBs
NCBI-GeneID: 71678
NCBI-ProteinID: NP_082137
MGI: 1918928
Ensembl: ENSMUSG00000046836
Vega: OTTMUSG00000050558
UniProt: Q8K2Q7
Position
1; 1 H5
AA seq 411 aa
MTHWFHRNPLKATAPVSFNYYGMITGPPASKICNDLRSARTRLLELFTDLSCNPETMKNA
ADLYFSLLQGFINSVGDSTQESKLRYIQNFKWTDTLQGHVPSAQQDAVFELISMGFNVAL
WYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHIPKLLTPAEKGRDLEARLI
DAYIIQCQAEAQEVTIARAIELKHAPGLIAALAYDTASFYQKADHTLSSLEPAHSAKWRK
YLHLKMCFYTAYAYCYHGQTLLASDKCGEAIRSLQEAEKLYAEAEALCKEYGETKGPGPT
AKPSGHLFFRKLGSLVKNTLDKCQRENGFIYFQKIPTEAPQLELKANYGLVEPVPFEFPP
MSAHWTPEALAAFDLTKRPKDDSVKPKPEEDVKPVKEPDIRPQKDTGCSVS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgacccattggtttcataggaacccattaaaagctacagctcccgtgtcttttaactac
tatggcatgatcactggtcctcccgcttcaaagatttgcaatgacttgaggtccgccagg
actcggctcctcgagttgttcactgatttgagctgtaatccagaaacaatgaagaatgcg
gcagacttgtatttctctcttttacaaggtttcataaattcagtgggtgactctacacag
gaaagcaaattacgatacattcagaatttcaagtggaccgatacattgcaaggacacgtt
ccgagtgcccagcaggatgctgtttttgaactgatttccatgggatttaatgtagcgctg
tggtacacaaaatatgcttcaagattggctggaaaagaaaacataacagaagatgaagca
aaagaagttcaccgaagcctaaaaattgcagctgggatttttaaacatttaaaggaaagt
catatccccaaacttcttacaccagcagaaaaggggcgggacttggaggctcggctcatc
gatgcttacatcatccagtgccaggccgaggctcaggaagtgacaatcgcccgagccatt
gagctgaagcacgctccgggactgatcgctgcactcgcctatgacacagccagcttctac
cagaaagcagatcatactttgtccagtttggagcctgcacactctgctaaatggagaaag
taccttcacttgaagatgtgcttctacacagcgtatgcgtattgctaccatggccagact
ctgttggcgagcgataagtgtggagaagccatccgatctctccaagaagcagaaaaattg
tacgcagaggcagaagccctatgcaaagagtacggggaaaccaaaggaccagggccgacg
gccaagccgtcaggacacttgttcttccggaagcttgggagccttgtgaagaacaccctg
gacaaatgtcagagagaaaatggcttcatttactttcaaaaaattccaacagaagcccca
caactggaactcaaagcaaattatgggctggtagagcctgtgccttttgaattccctcct
atgagtgctcactggacaccggaagcgttggctgcgtttgatctcaccaagagacccaag
gatgacagtgtcaaacccaaaccggaagaggacgtgaaacctgtaaaggaaccagatatc
agacctcagaaggacactgggtgctcggtctcataa

DBGET integrated database retrieval system