KEGG   Mus musculus (mouse): 71683
Entry
71683             CDS       T01002                                 

Symbol
Gypc, 0610037F22Rik, Cd236r
Name
(RefSeq) glycophorin C
  KO
K06576  glycophorin C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    71683 (Gypc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    71683 (Gypc)
CD molecules [BR:mmu04090]
 Proteins
  71683 (Gypc)
SSDB
Motif
Pfam: Syndecan Herpes_gp2 RIFIN PRIMA1 DUF4692 Protocadherin m04gp34like EVC2_like Myc_target_1
Other DBs
NCBI-GeneID: 71683
NCBI-ProteinID: NP_001041672
MGI: 1098566
Ensembl: ENSMUSG00000090523
Vega: OTTMUSG00000037029
UniProt: Q78HU7
Position
18:complement(32661373..32693087)
AA seq 95 aa
MSSPVSKPPPELLEPNPGKSYGIMEIAIIAAVITAVALVLVCLLFLMLRYLYRHKGTYHT
NEAKGTEFAESADAALQSDPALQDAGDTSKKEYFI
NT seq 288 nt   +upstreamnt  +downstreamnt
atgagcagcccggtcagcaagccgcctcccgagctcctcgagcctaacccagggaagtcc
tacggcattatggagattgccatcattgcagctgtgatcactgctgtggccttggtcctg
gtctgcctcctctttctcatgcttcgctacctgtacaggcacaagggtacctaccacacc
aatgaggccaaaggcacagagtttgcagagagtgctgatgcagccctgcaaagtgaccct
gccctccaggatgctggggacaccagcaagaaggaatactttatctga

DBGET integrated database retrieval system