KEGG   Mus musculus (mouse): 71684
Entry
71684             CDS       T01002                                 

Gene name
Rbm43, 0610033I05Rik
Definition
(RefSeq) RNA binding motif protein 43
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Nup35_RRM_2 RRM_1
Other DBs
NCBI-GeneID: 71684
NCBI-ProteinID: NP_001135453
MGI: 1918934
Ensembl: ENSMUSG00000036249
Vega: OTTMUSG00000012408
UniProt: Q99J64
Position
2; 2 C1.1
AA seq 343 aa
MASAWKVKDPTVAERTVVVSGLPVGLLKDQLVKCYFQDEGGHVEEVIYPSKSKGVAYIIF
KEKKVAQDFIRQKKHPPGSEPRLTVSHFSEKVFNYVMAILDLSVFRTQIELESLVVDLKK
KIPTLNFSPLGPSGKISVQGSFLAIMKLKQALISKAISPLENNRKDAGERRNWNGENPRR
ILQKRENSASILGTFVAEPAGSPETLVLDTDIFLYLKHKCEFYHLTLSKYHVLCQERVDG
DVTTICLQDAQDGSCSGSVRHVKEFIEECAQEFHLELRKELLVLEGMGDREKRNIRQALE
ELGGRYPRVLTNVHSTHIDLIGPPSDTYLFKTQLMKSAGQKVT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcatcagcgtggaaggtcaaagatcctacagttgctgagagaacagttgtagtctct
ggacttccagttggccttttaaaggaccagttagtgaagtgctacttccaagacgagggt
ggacatgtggaagaggtgatatatccatcaaaatccaaaggagttgcgtatatcatcttc
aaggaaaagaaagttgcacaagacttcatcagacaaaagaaacaccctccaggctcagag
cctcggctcacagtctctcacttcagtgaaaaggtcttcaactatgtgatggccattctt
gatctgtctgtttttcgcactcaaattgagctagaaagcctagtagtggacctgaaaaag
aaaatcccaactttaaactttagcccattgggacccagtgggaaaatctctgtgcaaggt
tcatttctggccatcatgaagctcaaacaggctttgatatcaaaagccatttccccttta
gaaaacaacaggaaagatgctggtgaaaggagaaactggaatggagagaaccctagaagg
atcctgcagaaaagggagaactcggcgtcgatacttgggacctttgtagctgagcctgcc
ggcagcccagaaacacttgtgcttgacacagacattttcctttatctgaaacacaagtgt
gagttttatcatctaacactgagcaaataccatgtcctgtgtcaggagagggtggatggt
gacgtcactaccatttgtctacaagacgcccaggatgggtcttgctctggcagcgtcaga
catgtgaaagaattcattgaagagtgtgcccaggagttccaccttgagctcagaaaagag
ctactggttttggaaggaatgggagatagagagaaaagaaacattaggcaggctttagaa
gaactgggtggcagatatcctagagttttgaccaacgttcacagcacacatattgatctt
ataggacctccttccgacacatacctatttaagacacagctcatgaaatctgcggggcaa
aaggtcacttga

DBGET integrated database retrieval system