KEGG   Mus musculus (mouse): 71685
Entry
71685             CDS       T01002                                 

Symbol
Galnt14, 0610033M06Rik
Name
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 14
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    71685 (Galnt14)
   00514 Other types of O-glycan biosynthesis
    71685 (Galnt14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    71685 (Galnt14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     71685 (Galnt14)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  Mucin-type
   71685 (Galnt14)
SSDB
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_2 Glyco_transf_7C
Other DBs
NCBI-GeneID: 71685
NCBI-ProteinID: NP_082140
MGI: 1918935
Ensembl: ENSMUSG00000024064
Vega: OTTMUSG00000026110
UniProt: Q8BVG5 Q08EC9
Position
17; 17 E2
AA seq 550 aa
MRRLTRRLALPIFGVLWITVLLFFWVTKRKLEVPLGPEVQTPKPSDADWDDLWEQFDERR
YLNAKKWRVGDDPYKLYAFNQRESERISSNRAVPDTRHKRCSLLVYCTDLPPTSIIITFH
NEARSTLLRTIRSVLNRTPMHLIQEIILVDDFSNDPEDCKQLIKLPKVKCLRNNERQGLV
RSRMRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFNYIE
SASELRGGFDWSLHFQWEQLSLEQKALRLDPTEPIRTPIIAGGLFVIDKAWFDYLGKYDV
DMDIWGGENFEISFRVWMCGGGLEIIPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAE
VWMDEYKQYYYAARPFALERPFGNIENRLNLRKNLHCQTFKWYLENVYPELRVPPDSSIQ
KGNIRQRQKCLESQKQKKQEILRLSPCAKVKGDGAKSQVWAFTYTQQIIQEELCLSVVTL
FPGAPVVLALCKNGDERQLWTKTGARIEHIASHLCLDTDMFGDSTEDGKEVVVNPCESSL
MSQHWDIVSS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgcggcggctgactcgccgcttggcgctgcccatctttggggtgctctggatcaccgta
ctgctgttcttctgggtcaccaagaggaagttggaggtgccgctgggacccgaagtgcag
acccccaagccttccgatgcggactgggatgacctgtgggagcagtttgatgagcggcgg
tatctgaatgccaaaaagtggcgtgtcggtgatgatccctacaaactgtatgctttcaac
caacgggagagtgagcggatatcgagcaatcgggctgtcccagacacacgtcataagaga
tgttcgctgcttgtgtattgcacggaccttcctcccaccagcatcatcatcaccttccac
aacgaggcacgttccactctactcagaaccatccgcagtgtgttaaaccgaacccctatg
catctgatccaggaaatcatattagtggatgactttagcaatgaccccgaggactgcaag
caactcatcaaattgcccaaggtgaagtgcttgcgcaacaatgagcggcaaggtctggtc
cggtctcggatgcgaggtgctgacattgcccaaggcaccactctgaccttcctggacagc
cattgtgaggtgaacagggattggctgcagcccctgttacacagggtcaaagaggactac
acaagggttgtgtgccctgtgattgacatcattaacctggataccttcaactatattgag
tctgcctcagagctcagagggggctttgactggagcctgcacttccagtgggagcagctc
tccctggagcagaaagctttgcgcctagaccctactgagcccatccggactccaatcata
gccggagggctcttcgtgatcgacaaagcctggttcgattacctgggtaaatatgacgtc
gacatggacatctggggtggggagaactttgaaatctctttccgagtgtggatgtgtgga
ggtggcctggagatcatcccttgcagccgggtgggacatgtcttcagaaaaaagcatcct
tatgttttccccgatgggaacgccaacacatatataaagaacaccaagaggacagctgaa
gtatggatggatgaatacaagcagtactactatgcagctcggccttttgccctggagaga
ccctttggaaacattgagaacaggctgaacctgaggaagaatcttcactgccagaccttc
aagtggtacctagagaatgtctacccagaactcagggtccccccagactcctccatccag
aagggcaatatccggcagcggcagaagtgccttgagtctcaaaagcagaaaaaacaggag
attctcaggctaagtccctgtgccaaggtcaaaggagatggagcaaagtctcaggtgtgg
gccttcacatacacccagcagatcatccaagaagagctgtgcctgtccgtggtcaccctg
tttcctggtgcccccgtggttcttgctctatgcaagaatggggatgaaaggcagctatgg
accaagactggtgcccgaattgagcacatagcatctcacctctgcctggatacagacatg
tttggtgacagcaccgaggatggcaaggaggtcgttgtcaacccttgtgagtcgtcgctc
atgagccagcactgggacattgtgagctcatga

DBGET integrated database retrieval system