KEGG   Mus musculus (mouse): 71687
Entry
71687             CDS       T01002                                 

Gene name
Tmem25, 0610039J01Rik, AI429491
Definition
(RefSeq) transmembrane protein 25
  KO
K22652  transmembrane protein 25
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    71687 (Tmem25)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  TMEM25
   71687 (Tmem25)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 71687
NCBI-ProteinID: NP_082141
MGI: 1918937
Ensembl: ENSMUSG00000002032
Vega: OTTMUSG00000016729
UniProt: Q9DCF1
Position
9; 9 A5.2
AA seq 365 aa
MELPLSQATLRHTLLLLPALLSSGQGELAPQIDGQTWAERALRENEHHAFTCRVAGGSAT
PRLAWYLDGQLQEATTSRLLSVGGDAFSGGTSTFTVTAQRSQHELNCSLQDPGSGRPANA
SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNASDFL
VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRIEVPLLGIVV
AGGLALGTLVGFSTLVACLVCRKEKKTKGPSRRPSLISSDSNNLKLNNVRLPRENMSLPS
NLQLNDLTPDLRGKATERPMAQHSSRPELLEAEPGGLLTSRGFIRLPMLGYIYRVSSVSS
DEIWL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggaattgcctctaagccaagctaccctccggcacacactgctgctccttcctgccctc
ttaagttcaggtcaaggggagctggcgccgcaaattgatggtcagacctgggctgagaga
gcgcttagggagaatgagcaccatgccttcacctgtcgggttgcaggaggttctgccact
ccccgattagcctggtacctggatggacagctacaggaggccaccacctcccgactgctg
agtgtgggtggggacgccttctctggaggaaccagcactttcactgttactgcccagcgc
tcccaacatgagcttaactgctccctgcaggacccagggagtggccggccagccaatgcc
tctgtcatcctcaatgtgcaattcaaaccagagattgcccaggttggagccaaataccag
gaagctcagggcccaggccttctggttgtcctgtttgccctggtgcgggccaacccacct
gccaatgtcacctggattgaccaggatgggccagtgactgtcaatgcctctgacttcctg
gtgctggatgctcagaactatccctggctcaccaaccacactgtgcagctgcagctccgg
agcttggcacacaacctctcggtggtggccaccaatgacgtgggtgtcactagcgcttcc
cttccagctccagggctcctggccacacggatagaagtgccactgctgggcatcgttgtg
gctggaggacttgccttgggcactctagtggggttcagtaccttggtggcctgcctggtc
tgcaggaaagagaagaaaacaaaaggcccctcccggcgtccttctctgatatctagtgac
tccaataacctgaaactgaataatgtgcgcctgccacgggagaacatgtccctcccatcc
aaccttcagctcaatgacctcactccagatctcagagggaaagcaacagagcggccaatg
gctcagcatagcagccgtccagagcttctagaagccgagcctggtggcctcctcaccagc
cgaggtttcatccgtctcccgatgttgggctacatctaccgtgtgtccagtgtaagcagt
gatgagatttggctctga

DBGET integrated database retrieval system