KEGG   Mus musculus (mouse): 71718
Entry
71718             CDS       T01002                                 

Gene name
Telo2, 1200003M09Rik, AI415602, Tel2, mKIAA0683
Definition
(RefSeq) telomere maintenance 2
  KO
K11137  telomere length regulation protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03460  Fanconi anemia pathway
mmu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    71718 (Telo2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    71718 (Telo2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    71718 (Telo2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    71718 (Telo2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     71718 (Telo2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     71718 (Telo2)
  Check point factors
   Triple T complex
    71718 (Telo2)
SSDB
Motif
Pfam: Telomere_reg-2
Other DBs
NCBI-GeneID: 71718
NCBI-ProteinID: NP_001157133
MGI: 1918968
Ensembl: ENSMUSG00000024170
Vega: OTTMUSG00000030783
UniProt: Q9DC40
Position
17; 17 A3.3
AA seq 840 aa
MDPALSAVRLTVQEAIHILSSSEDAGHILSTLGTLKRYLGGTEDPVLPEEKEEFATVHFS
AVLRCLVSKLSPGWLELSPGGQLERLWESFFLDGPPDQAFLVLMEAIESTAGPSFRLMKM
AQLLDTFLSTGRVAALMEEQCRPQTKPSFPLFQETLLSKVVGLPDLLGNCLQRDNLTQFF
PQNYFPLLGQEVVQALKAVVNFLQDGLDCSVSFVSRVLGKVCIQGRKREILSVLVPQLTV
LTQDSCLWQRVCWRLVEQVPDRAVEAVLTGLVEAAPRPEVLSRLLGNLVVKNKKARFVVT
RKLLLLQYQHTTPMVQSLLGYLALDSQRRPLLIQVLKELLETWGCSSAVRHTPLEQQCYI
SKAILVCLAHLGEPELQDIRDELLASMMAGVKCRLDSSLPPVRRLGMIVAEVISSRIHPE
GPLLKFQYEDDEMSRELLALATPEPAGDCSSVSRGPSPAPVDTESPVEMPEKAVESDVPP
TQPQGSDSELDSDDEFIPYDMSGDRELKSSKEPLYIRDCVEALTTSEDMERWEASLKGLE
GLVYRSPTATREVSVELAKVLLHLEEKTCVAEFEQLRQSALVAVTVTDPEQVAKYLTSQF
YGLNYSLRQRMDILDVLVLAAQALSRPKSLQRRSQHGPPVPGTMCSPALAVSQTGNVAAP
DWQVVVEERIRSKTRRFSKGCPQRELSGVPNEFSSVAGYFFFPLLQHFDRPLVTFDLLGD
DQLVLGRLTHTLASLMYLAVNTTVAVPMGKALLEFVWALRFHVDIYVRRGLLSAVSSVLL
SVPTERLLGDLPDELLEARSWLADVAEKDVDEDCRELAVRALLLLERLKDKLLSSSSPQP
NT seq 2523 nt   +upstreamnt  +downstreamnt
atggacccagccctgtctgctgtccggctcaccgtccaggaagccattcacatcctttca
tcctcagaggatgctggccatatcctttctaccctggggactctgaaacgatacctcggt
ggaaccgaggatccagttcttcctgaggagaaggaggagtttgccactgtccacttctca
gccgtccttagatgtctggtcagcaagctgagcccaggttggctggagctgtcccccggt
ggccagctggagcggctttgggagagcttcttcctggatggccctccagaccaagccttc
ctggtgctgatggaagccattgagagcactgctggccctagcttccgtctgatgaagatg
gctcagctgctggacacatttctgagcacgggcagagtggctgctctaatggaggagcag
tgtcggccacagacaaagcccagctttcccctgttccaggagacgctgctcagcaaggtt
gtgggcttacctgatctcctgggcaactgtctccagcgggacaacctgacccagttcttc
ccccagaactacttccctctgcttggccaggaggttgtgcaggcactaaaggcagttgtg
aactttctccaagatggcctagactgctctgtctccttcgtatctcgagttcttgggaag
gtctgcatccagggccgaaagagagagatcctgagtgtgctggtgccccagctgacagtg
ctcacccaggacagctgtctgtggcagcgggtgtgctggcgcctggtggagcaggtgcct
gaccgggcagtggaggctgtgctgacaggacttgtagaggctgctcccaggcctgaagtc
ctgtcacgactactagggaacctggtggtgaagaataagaaagcgcggtttgtggttacc
cgcaagctcctgctcctgcagtaccagcacacgacacccatggtgcagagcctgttgggg
tacttggctctagacagtcagcggcggccactcctcatacaggtgcttaaggagctgctg
gagacctggggctgcagcagtgctgtccgacacacacccctggagcagcagtgttacatc
agcaaggccatccttgtctgcctggcacacctcggggagccggagctgcaggacatccgg
gatgaattgctggccagcatgatggcaggcgtgaagtgccgcctggatagcagcctgccc
cctgtgcgccgcttgggcatgattgtggccgaggtcatcagctccaggatccaccctgag
gggcctctcctgaaattccaatatgaagatgacgagatgagccgtgagttgctggctttg
gctaccccggagcctgcgggtgactgctcctcggtgtcacgaggcccatccccagctcct
gttgacacagagtctcctgtagagatgccagaaaaggccgtggagagtgatgtcccccca
actcagcctcagggctctgactcggagctggacagtgacgatgagttcatcccctatgac
atgtcaggggacagagagctgaagagcagcaaggagcccctgtatatccgagactgcgtg
gaagctttgactacatctgaggacatggaacgctgggaggcgtccctaaaggggcttgag
ggcctggtatataggagccccacggccactcgggaggtgagtgtggagctggccaaagtg
ctactgcacctggaagagaagacctgtgtagcagagtttgagcagctgcgccagagcgct
ctggtagctgttacagtcacagacccggagcaggtagccaagtatctgacctcacagttc
tatggcctaaactatagcctccgccagcgcatggacatcctggacgtccttgttctggct
gcccaggcactgtctcggccaaagagcctgcagagacgttcccagcacggtccccccgtt
cctggcaccatgtgttcaccagcactagccgtttctcagactggcaatgtcgctgctcct
gactggcaggtggttgtggaggagcggatcagaagcaagacccggaggttctcgaagggc
tgtcctcagcgggagctgtcaggcgtccccaatgaattcagctctgtggctggctacttc
ttcttccccctccttcagcactttgacaggcctctggtgaccttcgaccttttaggagat
gatcagttggtacttggaagactgacccacaccttagcgtccctgatgtacctggctgtt
aacaccacagtggctgtgcctatgggtaaggccctgctggagtttgtatgggcccttcgc
ttccacgttgacatttacgtgcgccggggcttgctgtctgctgtgtcctctgtcctcctc
agtgtacccacagagcggctgctgggggacctgccagatgagctactggaagccagatcc
tggttggcagatgtggctgagaaggatgtggacgaggactgtagggagctggcagtaagg
gctctgctgcttctggagagactcaaagacaagctcctgtccagttcctctccacagccc
tga

DBGET integrated database retrieval system