KEGG   Mus musculus (house mouse): 71726
Entry
71726             CDS       T01002                                 
Symbol
Smug1, 1200013B09Rik, A930006H09Rik, C85220
Name
(RefSeq) single-strand selective monofunctional uracil DNA glycosylase
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    71726 (Smug1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    71726 (Smug1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     71726 (Smug1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     71726 (Smug1)
 Prokaryotic type
     71726 (Smug1)
SSDB
Motif
Pfam: UDG DUF4918
Other DBs
NCBI-GeneID: 71726
NCBI-ProteinID: NP_082161
MGI: 1918976
Ensembl: ENSMUSG00000036061
UniProt: Q6P5C5
Position
15:complement(103061717..103077360)
AA seq 279 aa
MAASQTFPLGPTHEPASALMEPLPCTRSLAEGFLEEELRLNAELSQLQFPEPVGVIYNPV
DYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGVGGPVLTPP
QEHPKRPVLGLECPQSEVSGARFWGFFRTLCGQPQVFFRHCFVHNLCPLLFLAPSGRNLT
PAELPAKQREQLLSICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLL
HPSPRSAQANKGWEAAARERLQELGLLPLLTDEGSARPT
NT seq 840 nt   +upstreamnt  +downstreamnt
atggctgcgtcccagaccttcccactggggcctacccatgagcctgcaagcgccctgatg
gagcctctgccttgtacacgaagcttggctgagggcttcctggaggaggagcttcggctc
aatgccgagctgagccagctgcagttcccggagcccgtgggtgtcatctacaacccggtg
gattatgcttgggagccacaccgtaactatgtgactcgctactgccaaggccccaaggaa
gtgctgttcttgggcatgaacccaggaccttttggcatggcccaaacaggggtacccttt
ggggaagtgaatgtggtccgggactggttgggcgttgggggccctgtgctgacccctcca
caagagcaccccaagcgaccagtgttgggactggagtgcccacagtcagaggtgagcgga
gcccgattctggggctttttccggaccctctgcggacagcctcaagtcttcttccggcac
tgctttgtccacaatctgtgtcctctactcttcttggctcccagtggacgaaaccttacc
ccagctgagctgcccgccaagcagcgggagcagctgctgtcgatctgcgacgcagccctc
tgccggcaggtgcagctgctaggggtgcgtctggtagtgggagtggggcggctggcagag
cagcgagcccgaagagctctagcagggctgaccccggaggtgcaggtggaggggctcctg
catccatctcctcgaagcgcacaggccaacaaaggctgggaggcggcagccagggaaaga
ctccaggagttggggctgctgcctctgctaacggatgagggttcagccagacctacatag

DBGET integrated database retrieval system