KEGG   Mus musculus (mouse): 71732
Entry
71732             CDS       T01002                                 

Symbol
Vps11, 1200011A11Rik
Name
(RefSeq) VPS11, CORVET/HOPS core subunit
  KO
K20179  vacuolar protein sorting-associated protein 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    71732 (Vps11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71732 (Vps11)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    71732 (Vps11)
   Hops complex
    71732 (Vps11)
SSDB
Motif
Pfam: VPS11_C Clathrin zf-C3HC4_2 zf-RING_2 zf-RING_UBOX zf-rbx1 zf-C3HC4 zf-C3H2C3 zf-RING_5 zf-C3HC4_3 TPR_11 DLP_helical DUF5847 zf-ANAPC11 zf-RING-like zf-C3HC4_4 zf-RING_11
Other DBs
NCBI-GeneID: 71732
NCBI-ProteinID: NP_082165
MGI: 1918982
Ensembl: ENSMUSG00000032127
Vega: OTTMUSG00000063261
UniProt: Q91W86
Position
9; 9 A5.2
AA seq 941 aa
MAAYLQWRRFVFFEKELVKEPLGNDGAAPGAAPVSGSAASKFLCLPPGITVCDSGRGSLV
FGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILASVGEDEEGINPLVKIWNLEK
RDGGNPLCTRIFPAIPGTEPTVVSCLTVHENLNFMAIGFTDGSVTLNKGDITRDRHSKTQ
ILHKGNYPVTGLAFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGCGLRCSALSD
PSQDLQFIVAGDECVYLYQPDERGPCFAFEGHKLIVHWFRGYLVIVSRDRKVSPKSEFTS
RDSQNSDKQILNIYDLCNKFIAYSAGFEDIVDVLAEWGSLYVLTRDGRVHALQEKDTQTK
LEMLFKKNLFEMAINLAKSQHLDSDGLAQIFMQYGDHLYSKGNHDGAVQQYIRTIGKLEP
SYVIRKFLDAQRIHNLTAYLQTLHRQSLANADHTTLLLNCYTKLKDSSKLEEFIKTKSES
EVHFDVETAIKVLRQAGYYSHALYLAENHAHHEWYLKIQLEDIKNYQEALRYIGKLPFEQ
AESNMKRYGKTLMHHIPEQTTQLLKGLCTDYRPSLEGRGDREALSCRASSEEFIPIFANN
PRELKAFLEHMSEVQPDSPQGIYDTLLELRLQNWAHEKDPQAKEKLHAEAISLLKSGRFC
DVFDKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVIAVCERHGEQEPSLW
EQALSYFARKEEDCKEYVAAVLRHIENKSLMPPLLVVQTLAHNSTATLSIIRDYLVQKLQ
KQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGH
SFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIAD
YFGRGVFNKLTLLTDPPTARLTPSLEAGLQRDLLMHSRRGT
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggcggcctacctgcagtggcggcgtttcgttttcttcgagaaggagctggtgaaggag
ccgctgggtaatgatggggctgctcccggtgccgcgcctgtgtcgggatccgctgcttcc
aagttcctttgcctccctcctggcatcactgtctgcgactcaggccgcgggagcctggtc
tttggagatatggaaggccagatctggttcttgccacgttctctacagcttacagggttc
caggcctacaaactacgggtgacacacttatatcagctgaagcagcacaatattctggca
tcggttggtgaggatgaagagggtattaaccctctggtaaagatctggaacctggaaaag
agagacggtggcaatccactctgcacccggattttccctgccatcccagggacagagcca
actgttgtgtcttgtttgacggtccatgagaatctcaactttatggccattgggttcaca
gatggcagtgtcaccctgaacaagggagatattacccgggaccggcacagcaagacgcag
attttgcacaagggcaactatcccgttactgggctggcctttcgccaagcaggaaagacc
acccacttgtttgtcgtgacaactgaaaatgttcagtcttatatagtttctggaaaggac
taccctcgtgtggagttggacacccatggttgtggcctgcgctgttcagccctgagcgac
ccttctcaagacctgcagttcattgttgctggggatgagtgtgtctacctttaccagcct
gatgaacgtggaccctgctttgcctttgagggccataagctcatcgtgcactggtttaga
ggctaccttgtcattgtctcccgtgaccggaaagtttctcccaagtccgagtttaccagc
agggactcacagaactccgacaagcagattctcaacatctatgacctgtgcaacaagttc
atagcctacagcgctgggtttgaggatatagtggatgtgctggctgagtggggctccttg
tacgtgctgacgcgggatgggcgggtccacgcattgcaggagaaggacacacagaccaaa
ctggagatgctgtttaagaagaatctatttgagatggcaattaatctggctaagagtcaa
catttggacagtgatgggttggctcaaatcttcatgcagtatggagaccatctctacagc
aagggcaaccatgatggggctgtgcagcagtatatccgaaccattggaaagttggagcca
tcctatgtgatccggaagtttctggatgcccagcgcatccacaacttgaccgcctacctg
caaaccctgcatcggcagtctctggctaatgctgatcataccaccctgcttctgaactgc
tataccaagctcaaggacagctcgaagctggaggaattcatcaagacaaagagtgagagt
gaagtccactttgatgtagagacagccatcaaggtcctccggcaggctggctactactcc
catgccctctatctggctgagaatcatgcacatcatgagtggtacttgaagatccagcta
gaggacattaagaactatcaggaagcccttcggtatatcgggaagctgcctttcgagcaa
gcggagagtaacatgaaacgctatggcaagaccctcatgcaccacataccggagcagaca
acccagttgctgaaaggcctctgcactgactatcgacccagtctggaaggccgaggcgat
cgggaggctctgagctgccgggccagttctgaggagttcatccccatctttgccaacaac
ccacgagagctgaaagccttcctagaacacatgagtgaggtgcagccggactcaccgcag
ggcatctatgacacgctcctggagctgcggctgcagaactgggcccatgagaaagatccc
caggccaaggagaaacttcatgcagaggccatctccctgctgaagagtggccgattctgt
gacgtgtttgacaaggcattggttctgtgccagatgcacgacttccaggatggggtcctt
tacctctatgagcaggggaagctgttccagcagatcatgcattaccacatgcagcacgag
cagtaccggcaggtgattgccgtgtgtgagcgccatggagagcaggagccctccctgtgg
gaacaggccctcagctacttcgcccgcaaggaggaggactgcaaggagtatgtggcggct
gtgctcaggcacattgagaacaagagcctcatgccgcctcttctagtggtgcagaccctg
gcccacaactccacagctaccctgtctatcatccgagattacctggtccaaaaactgcag
aaacagagccagcagattgcacaggatgagctccgggtgcggcgatacagagaggagacc
actcgcatccgccaggaaatccaggagctcaaggcgagtccaaagattttccagaagacc
aagtgtagcatctgtaacagtgccttggagctgccctcagtccacttcctgtgtggccac
tccttccaccaacactgctttgagagttactcagaaagtgatgctgactgccccacctgc
ctccctgagaaccgcaaggtgatggatatgatccgggcccaggaacagaaacgagatctc
cacgatcagttccaacatcagctcaagtgctcgaatgacagcttctctgtgattgcggac
tactttggccgaggggttttcaacaagttgactctgctgaccgaccctcctacagccaga
ctgacccccagcctggaggctggactgcagcgggacctgctgatgcactccaggagggga
acttag

DBGET integrated database retrieval system