KEGG   Mus musculus (house mouse): 71740
Entry
71740             CDS       T01002                                 
Symbol
Nectin4, 1200017F15Rik, Prr4, Pvrl4
Name
(RefSeq) nectin cell adhesion molecule 4
  KO
K06593  poliovirus receptor-related 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    71740 (Nectin4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    71740 (Nectin4)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Nectin family
   71740 (Nectin4)
SSDB
Motif
Pfam: Ig_3 V-set ig C2-set_2 I-set Ig_2 Ig_6 EphA2_TM DUF4692 Protocadherin Chordopox_A13L C2-set Ctr TMEM154 Herpes_glycop DUF6161 RIFIN CD34_antigen Baculo_11_kDa
Other DBs
NCBI-GeneID: 71740
NCBI-ProteinID: NP_082169
MGI: 1918990
Ensembl: ENSMUSG00000006411
UniProt: Q8R007
Position
1:171197741..171215855
AA seq 508 aa
MPLSLGAEMWGPEAWLRLLFLASFTGQYSAGELETSDVVTVVLGQDAKLPCFYRGDPDEQ
VGQVAWARVDPNEGIRELALLHSKYGLHVNPAYEDRVEQPPPPRDPLDGSVLLRNAVQAD
EGEYECRVSTFPAGSFQARMRLRVLVPPLPSLNPGPPLEEGQGLTLAASCTAEGSPAPSV
TWDTEVKGTQSSRSFTHPRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDRRITHTLQ
VAFLAEASVRGLEDQNLWQVGREGATLKCLSEGQPPPKYNWTRLDGPLPSGVRVKGDTLG
FPPLTTEHSGVYVCHVSNELSSRDSQVTVEVLDPEDPGKQVDLVSASVIIVGVIAALLFC
LLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHSDPRSQPEESVGLRAEG
HPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRTEEDDDQDEGIKQAM
NHFVQENGTLRAKPTGNGIYINGRGHLV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgcccctgtccctgggagccgagatgtggggccctgaagcctggctgcggctgttgttc
ctggcatcgtttacaggccaatattccgcgggtgagctggagacctctgacgtagtgaca
gtggtgctgggtcaggatgcaaaactgccctgcttctaccgaggggatccggatgagcag
gtggggcaggtggcatgggctcgagtggacccaaacgagggtatccgggagctggcccta
ctgcactccaaatacgggcttcatgtgaaccctgcttatgaggaccgcgtggagcaacca
ccgcccccacgagaccctctagacggctcggtcctcctgcgcaacgctgtgcaagctgat
gagggcgagtacgaatgcagagtcagcaccttcccagccggcagctttcaggcacggatg
cgtcttcgtgttctggtgcctcctctgccttcactgaatcctggtccaccactagaagag
ggccagggcctgacgttggcagcctcttgcactgctgagggcagcccagctcccagcgtg
acctgggacacagaggtcaagggcacacagtcgagccgctctttcacacacccacgctca
gctgccgtcacttcagagttccatctggtgcccagccgaagtatgaatgggcagccgctg
acctgcgtggtgtctcaccctggcctgctccaggaccgaagaatcacccacaccctccaa
gtggccttccttgcggaggcctctgtgaggggccttgaggaccaaaacttgtggcaagtc
ggccgagaaggagccacactcaaatgcctgagtgaaggacagccccctcccaaatacaac
tggacacggttggatggacctctgcctagtggggtacgagtgaaaggagacactctgggc
tttcccccactgactactgagcacagtggcgtctacgtctgtcacgtcagcaatgagctt
tcttcgagggattctcaggtcactgtggaagttcttgaccccgaagatccaggaaagcag
gtggacctggtgtccgcctcagtgatcatagtgggcgtgatcgctgctctcctgttctgc
ctcctggtggtggtggtggtgctcatgtcccgatatcatcgccgcaaagcccagcagatg
acccagaaatatgaggaggagctgactttgaccagggagaactccatcaggaggctgcac
tctcaccactcggaccctaggagccagccggaggagagtgtagggctgagagcggagggc
caccctgatagtctcaaggacaacagtagctgctctgtgatgagtgaagagccagaaggc
cgcagctactccacgttaaccacagtgagagagatcgagacacagaccgaactgctatct
ccaggctctgggaggacagaggaggacgacgatcaggatgaaggcatcaaacaggccatg
aaccattttgtgcaggaaaatgggaccctgagggccaaacctacaggcaatggtatctac
atcaacgggcgagggcacctggtctga

DBGET integrated database retrieval system