KEGG   Mus musculus (mouse): 71742Help
Entry
71742             CDS       T01002                                 

Gene name
Ulk3, 1200015E14Rik
Definition
(RefSeq) unc-51-like kinase 3
  KO
K21358  serine/threonine-protein kinase ULK3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    71742 (Ulk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     71742 (Ulk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   71742 (Ulk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr MIT Kdo Choline_kinase RIO1 APH
Motif
Other DBs
NCBI-GeneID: 71742
NCBI-ProteinID: NP_082171
MGI: 1918992
Ensembl: ENSMUSG00000032308
Vega: OTTMUSG00000063191
UniProt: Q3U3Q1
Position
9; 9 B
AA seq 472 aa AA seqDB search
MAGPSWGLPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLL
TEIEILKGIRHPHIVQLKDFQWDNDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQ
LASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYM
APEMVCRRQYDARVDLWSVGVILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPQLS
LDCRDLLQRLLERDPARRISFKDFFAHPWVDLEHMPSGESLAQARALVVEAVKKDQEGDA
AAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSSSNQALLRQGT
TVQELLREMARDKPRLLAALEVASAALAKEEEAGKEQDALDLYQHSLGELLVLLAAEAPG
RRRELLHTEVQNLMARAEYLKEQIKIRESHWEAESLDKEGLSESVRSSCTLQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcccagctggggtctccctcggctggacggtttcatccttaccgagcgcctg
ggcagtggcacgtacgccacggtgtacaaggcctacgccaagaaggatactcgggaagtg
gtagccataaaatgcgtggccaagaagagtctcaacaaggcgtcagtggaaaacctcctg
actgagattgagatcctcaagggcattcggcacccccatatcgtgcagctgaaagacttc
cagtgggacaatgacaatatctacctcatcatggagttctgtgcagggggtgacctgtct
cgcttcattcatacccgcaggatcctgcctgagaaggtggcccgtgttttcatgcagcag
ttggctagtgccctgcagttcctgcatgaacgaaacatctctcacttggatctgaaaccg
cagaacatcctgctgagctctttggagaagccccacctgaaactggcagactttggcttt
gcccagcacatgtccccgtgggacgaaaaacacgtgctccgtggctccccgctctatatg
gctcctgagatggtgtgtcggcggcagtatgatgcgcgtgtggacctctggtctgtgggg
gtgatcctgtacgaagccctctttgggcagcccccctttgcctccagatcgttctcagag
ctagaagaaaagattcgcagcaatcgggtgattgagctccctcttcggccccaactctcc
ctagactgccgggacctgttgcagcgacttctagagcgggaccccgcccgtcgaatctcc
ttcaaggacttctttgcccatccctgggtggacctggagcacatgcccagtggggagagc
ctggcacaggcaagggcccttgtggtggaggctgtgaagaaggaccaggagggggatgct
gccgctgccctgtcgctctactgcaaggctctggacttctttgtacctgcgctacactac
gaagtggatgcccagaggaaggaggcaattaaggcgaaggtgggacagtatgtgtcccgg
gcagaggagctcaaagccattgtctcctcctccaatcaggccctgctaagacagggcaca
actgtccaagagctgcttcgagagatggcccgtgacaaaccacgcctcctggctgccctg
gaagtggcctcagctgccctggccaaggaggaggaagctggcaaagagcaggatgccctg
gacctgtaccagcacagcctcggggagctgctagtgctgttggcagcagaggccccaggc
cgaaggcgggagctccttcacaccgaggttcagaacctcatggctcgagctgaatacctg
aaggagcagatcaagataagggagtctcactgggaagcggagagtctggacaaagagggg
ctgtcggagtctgttcgtagttcttgcacactgcagtga

DBGET integrated database retrieval system