KEGG   Mus musculus (mouse): 71745Help
Entry
71745             CDS       T01002                                 

Gene name
Cul2, 1300003D18Rik, 4932411N15Rik, AI327301, mKIAA4106
Definition
(RefSeq) cullin 2
  KO
K03870  cullin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    71745 (Cul2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    71745 (Cul2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    71745 (Cul2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    71745 (Cul2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    71745 (Cul2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Cullin
     71745 (Cul2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 Rio2_N TFIIE_alpha
Motif
Other DBs
NCBI-GeneID: 71745
NCBI-ProteinID: NP_083678
MGI: 1918995
Ensembl: ENSMUSG00000024231
Vega: OTTMUSG00000034308
UniProt: Q9D4H8
Position
18; 18 A1
AA seq 745 aa AA seqDB search
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAE
TKIFLESHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTE
ADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHSECHSIIQQERKNDMANMYVL
LRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFIT
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKD
TPQELEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaaaccaagagtagtggattttgatgagacatggaacaaactcctaactaca
atcaaagctgttgttatgttggaatatgtcgagcgagcaacatggaatgaccgcttctca
gatatctatgctttatgtgtggcctatcctgaaccacttggagaaagactttatgcggaa
acaaagatttttttggaaagtcacgttcggcatttgtataagagagttctggagtctgaa
gaacaagtgcttgttatgtatcataggtactgggaagaatacagcaaaggcgccgactat
atggactgcttatataggtatctcaatacccagtatattaaaaagaataaattgacagaa
gctgatatacagtatggctatggtggagtagatatgaatgaaccacttatggaaatagga
gagctagcattggatatgtggaggaagttaatggttgaaccccttcagaacatcctcatc
cggatgctgcttcgagaaattaaaaatgatcgtggtggtgaagatccaaaccagaaagta
atccatggggttattaactcctttgttcatgttgaacagtataagaaaaaatttccctta
aagttttatcagggaatattcgtgtctccctttctgactgaaacgggagaatattacaag
caagaagcttcaaatttattacaagaatcaaattgttcacagtatatggaaaaggttcta
ggtagattaaaagatgaagaaattagatgtcgaaaatatttgcatccaagttcatatact
aaagtgattcatgagtgtcagcagcggatggtagcagaccacttacagttcttacattca
gagtgccacagcatcattcagcaagagaggaagaacgacatggcaaatatgtacgtctta
ctccgtgctgtgtccagtggtttacctcatatgattgaggagctgcagaaacatatccat
gacgagggcctcagagcgaccagtaaccttactcaggaacatatgccaacactatttgtg
gaatcagttttggaagtacatggtaaattcgttcaacttatcaacactgttttgaatggt
gatcagcattttatgagtgctttagataaggcccttacatctgttgtaaattacagagaa
cccaagtctgtttgcaaagcgcctgaactgcttgctaagtactgtgacaacttgctaaag
aagtcagcgaaggggatgactgaaaatgaagtggaggacaagctcactagcttcatcaca
gttttcaagtacattgatgacaaggacgtctttcagaagttctatgcaagaatgctagca
aaacgtctaattcacgggttgtctatgtctatggattctgaagaagccatgatcaataaa
ttaaagcaagcctgtggttatgagtttaccagcaagctgcatcgaatgtatacagacatg
agtgtcagcgctgatttgaacaataagttcaacaatttcatcagaaaccaagacaccgtg
attgacttggggattagtttccaaatatatgttcttcaggctggtgcgtggcctctcact
caggctccttcatctacatttgcaattccccaagagctagagaaaagtgtacagatgttt
gaattgttttatagccagcatttcagtggacggaagctgacatggttgcattatctctgt
acaggtgaagttaaaatgaactatttgggaaaaccatatgtagctatggttacaacctac
caaatggcagttcttcttgcctttaacaacagtgaaactgtcagctacaaagaacttcaa
gacagtacccagatgaatgaaaaggagctgaccaaaacaatcaaatcattacttgatgtg
aaaatgattaaccatgattcagaaaaggaagatatcgatgcagaatcttcattttcatta
aatatgagcttcagcagtaagagaacaaaatttaagattactacgtcaatgcagaaggat
acgccacaagaactggaacagactagaagtgctgtagatgaggaccggaaaatgtatctt
caagctgctattgtccgcatcatgaaagcacgaaaagtgcttcggcacaacgccctcatt
caagaggtaatcagccagtcaagagccaggttcaatcccagtatcagcatgattaagaag
tgcatagaagttctgatagacaaacagtacatcgagcgcagccaagcatctgcagatgaa
tacagttacgtcgcatga

DBGET integrated database retrieval system