KEGG   Mus musculus (mouse): 71750
Entry
71750             CDS       T01002                                 

Gene name
R3hdm2, 1300003K24Rik, AU041262, mKIAA1002
Definition
(RefSeq) R3H domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SUZ R3H
Other DBs
NCBI-GeneID: 71750
NCBI-ProteinID: NP_001161764
MGI: 1919000
Ensembl: ENSMUSG00000025404
Vega: OTTMUSG00000035856
UniProt: Q80TM6
Position
10; 10 D3
AA seq 1044 aa
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEDVEKEGEENGLRQETQRRTSS
HGHARKRAKSNSKLKLVRSLAVCEESSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDV
SEKEDKDKSKEKVPRKMLSRDSSQEYTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEIL
DFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSSTRIPEQRFS
EHIKDEKNTEFQQRFILKRDDASMDRDDNQMRVPLQDGRRSKSIEEREEEYQRVRERIFA
RETGQNGYLNDIRLSKEAFSSSSHKRRQIFRGNREGLSRTSSSRQSSTDSELKSLEPRPW
SSTDSDGSVRSMRPPVTKASSFSGISILTRGDSIGSSKGGSAGRLSRPGMALGAPEVCNQ
VTSPQSVRGLLPCTAQQQQQQQQQQQQLPALPPTPQHQPPLNNHMISQPVPALQPSPQPV
QFSPSSCPQVLLPVSPPQQYNMAEDLSNPFGQMSLSRQGSTEAADPSSALFQPPLISQHP
QQASFIMASAGQPLPTSNYSTSSHAPPTQQVLPPQGYMQPPQQIQVSYYPPGQYPNSNQQ
YRPLSHPVAYSPQRGQQLPQASQQPGLQPMMSNQQQTAYQGMLGVQQPQNQGLLSNQRSS
MGGQMQGLVVQYTPLPSYQVPVGSDSQNVVQPSFQQPMLVPASQSVQGGLPTGGVPVYYS
MIPPAQQNGTSPSVGFLQPPGSEQYQMPQSPSPCSPPQMSQQYSGVSPSGPGVVVMQLNV
PNGPQAPQNPSMVQWSHCKYYSVEQRGQKPGDLYSPDGSPQANAQMGSSPVTSPTQSPAP
SPVTSLSNVCTGLSPLPVLTPFPRPGGPAQGDGRYSLLGQPLQYNLSICPPLLHGQSTYT
VHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEGITRTEADKLFTQLAM
SGAKIQWLKDAQGLPGAGGGDNSGTAENGRHPDLAALYTIVAVFPSPLAAQNASLRLNNS
VSRFKLRVAKKNYDLRILERASSQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgtctaacagtaacactactcaggagactctggaaataatgaaagaatcagaaaaaaaa
ctggtggaagaatctgtaaacaaaaataaatttatatccaaaactccaagtaaggaagac
gtcgagaaggagggtgaagagaatggtctgcgtcaggagacacagagacggacatccagt
catggccatgccaggaaaagagccaagtctaattccaaactcaagttggtgcgcagtctg
gcagtctgtgaggaatcctccactccatttgtcgatgggccactagacacccaggatata
attcaactgcacatcagctgcccctctgacaaggaggaagaaaagtccacaaaagatgtc
tctgaaaaggaagacaaggacaaaagcaaagaaaaggtcccaaggaagatgctatccaga
gactccagccaagaatataccgactccactggaatagatctacatgaatttcttgtaaat
acactgaaaaagaacccaagggacagaatgatgctgctaaagttagagcaagagattctg
gacttcatcaatgacaacaacaaccagttcaagaagttccctcagatgacctcatatcac
cggatgctattacatcgggtagctgcctactttgggatggaccacaatgttgatcaaaca
gggaaagctgtcatcatcaacaaaaccagcagcacgaggatccctgaacagaggttctca
gaacatataaaagatgaaaagaacacggaatttcaacagaggttcattctcaagagagat
gatgccagtatggaccgagatgataaccagatgagagttccattgcaggatggaaggagg
agcaagtcaatagaagagagagaggaggaatatcaaagggtccgagagagaatatttgcc
cgagagaccggccagaatggatatctgaatgacatcagactctccaaagaagccttttct
tctagctctcacaagagaaggcagatttttaggggaaaccgggaagggctgagccgtacc
tcaagcagccgacagagcagcacagacagcgagctcaagtccctggagccacggccttgg
agcagcacagactcagatggctctgtccgcagcatgcgacctcctgtcaccaaagccagc
agcttcagtggaatctccatcctcacccgaggcgacagcattggcagcagtaaaggcggc
agtgcaggcaggctctccaggccaggcatggcactaggtgccccagaagtgtgcaaccag
gtcacctcaccccagtctgtccggggccttcttccttgtactgcccagcagcagcagcag
caacaacaacaacaacaacaacttcctgctctcccacccactcctcaacaccagccaccc
ttgaataatcacatgatttcacagccagtcccggccctgcagccctctccacagccggtt
cagttttctccaagctcctgtccccaggtccttctgccagtctctccgccccagcagtac
aacatggcagaagacctcagcaacccctttggacaaatgagccttagccgccaaggttct
actgaagcagctgacccctcctcggctttgttccagcccccacttatctcccagcatcct
cagcaagctagtttcatcatggcttctgcaggacagccccttcccacttccaattattcc
acttctagccatgctccacctacccagcaagtcctgccaccccaaggctacatgcagccc
cctcaacagatccaggtttcttactaccctcctggacagtatcctaattccaaccagcaa
tatcgacctctgtctcacccggtggcctatagcccccagcgtggtcaacagctgcctcaa
gcatcccagcagcctggcttacagcccatgatgtctaaccagcagcagacggcttaccaa
ggcatgcttggggtccagcagcctcagaaccagggcctactcagcaaccagaggagcagc
atgggaggccagatgcaaggcctggtggtgcagtacactccactgccttcttaccaagtc
cctgtgggcagtgactcacaaaacgtggtccagccatccttccagcagcccatgctggtt
cctgccagccagtctgtgcaaggaggcctcccaacaggaggtgtgcctgtgtactacagc
atgatcccaccagctcagcagaacggaacgagcccttctgtgggctttctgcagcctcct
ggctctgagcagtaccagatgcctcagtctccctctccctgcagcccaccacagatgtca
cagcagtactcaggagtgtcaccttctggaccaggtgtggtggtcatgcaactgaatgtc
cctaacggaccccaggccccccagaatccatccatggtccaatggagtcactgcaaatac
tacagcgtggagcagcgtggtcagaagcctggagacctgtacagccctgatgggagcccc
caggccaacgcacaaatgggcagcagccccgtcacatctcctacccagtctccagcaccc
tctcctgtcacgagcctcagcaacgtctgcactggactcagccccctgcctgtcctcaca
ccattcccccggcctgggggtcctgcacagggtgacgggcgctattccctactgggtcag
ccattacagtacaatctgtccatctgccctcccttgctccatggccagtcaacttacacg
gtgcaccagggacagagcggattgaagcacggaaaccggggcaagagacaagcactgaaa
tctgcctccactgacctggggacagcagatgttgtgcttggaagggtgctggaggtgact
gacctccctgaaggaatcacccgtacggaggctgacaaactcttcacccagcttgccatg
tctggtgccaagatccagtggcttaaggatgctcaggggctgcctggtgcaggcgggggg
gacaacagtgggactgctgagaacggccgccacccggacctcgcagccctgtacacgata
gtggctgtgttccccagccccctggccgcccagaacgcctcccttcgcctcaacaactct
gtgagtcgcttcaaactccgagtggctaaaaagaactacgacctgaggatcctggaacga
gctagctctcaatag

DBGET integrated database retrieval system