KEGG   Mus musculus (mouse): 71779
Entry
71779             CDS       T01002                                 

Gene name
Marchf8, 1300017E09Rik, MARCH-VIII, March8, Mir
Definition
(RefSeq) membrane associated ring-CH-type finger 8
  KO
K10656  E3 ubiquitin-protein ligase MARCH1/8 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    71779 (Marchf8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     71779 (Marchf8)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   March proteins
    71779 (Marchf8)
SSDB
Motif
Pfam: RINGv DctQ zf-RING_2
Other DBs
NCBI-GeneID: 71779
NCBI-ProteinID: NP_001289312
MGI: 1919029
Ensembl: ENSMUSG00000025702
Vega: OTTMUSG00000016676
UniProt: Q9DBD2
Position
6; 6 E3
AA seq 286 aa
MSMPLHQISAIPSQDAISARVYRSKTKDKEQNEKTLGHSMSHPSNISKAGSSPPSTTAPV
SAFSRTSVTPSNQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCE
LCKYEFIMETKLKPLRKWEKLQMTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEI
KQGQVTGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYLQLWKRLKAYNRVIYVQNCPET
SKKNIFEKSALTEPTLENKEGHGMCHSTTNSSCTEPEDTGAEIINV
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagcatgccattgcaccagatctctgccatcccttctcaggatgccatttctgctaga
gtctacagaagcaagaccaaagataaggagcagaatgagaagactttgggacattccatg
agtcatccaagcaacatttctaaggctgggagtagtcctccatccacgacggctccagtg
tctgccttctctcgcacttctgtcacaccatccaaccaggacatctgcaggatctgccac
tgtgaaggggatgacgagagccctctgatcaccccctgtcactgcacagggagcctccat
ttcgtgcatcaggcttgcctgcagcagtggatcaagagttctgacacacgctgctgtgaa
ctctgcaagtacgagttcatcatggagaccaagctgaaacctttgaggaaatgggagaag
ttgcagatgactgccagtgagcgcaggaagatcatgtgctcagtgaccttccatgtcatt
gctatcacctgtgtggtctggtccttgtatgtgctcattgaccgcacagcagaggaaatc
aagcagggtcaggtaacaggaatcctagagtggcctttctggacgaagctggtagttgtg
gccatcggcttcactggaggacttctctttatgtatgttcagtgcaaggtgtacctacag
ttatggaaaagactcaaggcttacaatagagtgatctatgttcagaactgtccagaaaca
agtaaaaagaatatttttgaaaagtctgcacttacagagcccacccttgaaaataaagaa
ggacatggaatgtgtcattccaccacaaattcttcttgcacagagcctgaagacactgga
gcagaaattattaacgtctga

DBGET integrated database retrieval system