KEGG   Mus musculus (house mouse): 71785
Entry
71785             CDS       T01002                                 
Symbol
Pdgfd, 1110003I09Rik
Name
(RefSeq) platelet-derived growth factor, D polypeptide
  KO
K05450  platelet derived growth factor C/D
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    71785 (Pdgfd)
   04014 Ras signaling pathway
    71785 (Pdgfd)
   04015 Rap1 signaling pathway
    71785 (Pdgfd)
   04020 Calcium signaling pathway
    71785 (Pdgfd)
   04072 Phospholipase D signaling pathway
    71785 (Pdgfd)
   04151 PI3K-Akt signaling pathway
    71785 (Pdgfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    71785 (Pdgfd)
   04540 Gap junction
    71785 (Pdgfd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    71785 (Pdgfd)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    71785 (Pdgfd)
  09162 Cancer: specific types
   05218 Melanoma
    71785 (Pdgfd)
   05215 Prostate cancer
    71785 (Pdgfd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    71785 (Pdgfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    71785 (Pdgfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   71785 (Pdgfd)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 71785
NCBI-ProteinID: NP_082200
MGI: 1919035
Ensembl: ENSMUSG00000032006
UniProt: Q925I7
Position
9:6168377..6534284
AA seq 370 aa
MQRLVLVSILLCANFSCYPDTFATPQRASIKALRNANLRRDESNHLTDLYQREENIQVTS
NGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQLSFDHQFGLEEAENDICRYDFVEVEEVS
ESSTVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPEAASE
TNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLY
LDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQ
RCGGNCGCGTVNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaacggctcgttttagtctccattctcctgtgcgcgaactttagctgctatccggac
acttttgcgactccgcagagagcatccatcaaagctttgcgcaatgccaacctcaggaga
gatgagagcaatcacctcacagacttgtaccagagagaggagaacattcaggtgacaagc
aatggccatgtgcagagtcctcgcttcccgaacagctacccaaggaacctgcttctgaca
tggtggctccgttcccaggagaaaacacggatacaactgtcctttgaccatcaattcgga
ctagaggaagcagaaaatgacatttgtaggtatgactttgtggaagttgaagaagtctca
gagagcagcactgttgtcagaggaagatggtgtggccacaaggagatccctccaaggata
acgtcaagaacaaaccagattaaaatcacatttaagtctgatgactactttgtggcaaaa
cctggattcaagatttattattcatttgtggaagatttccaaccggaagcagcctcagag
accaactgggaatcagtcacaagctctttctctggggtgtcctatcactctccatcaata
acggaccccactctcactgctgatgccctggacaaaactgtcgcagaattcgataccgtg
gaagatctacttaagcacttcaatccagtgtcttggcaagatgatctggagaatttgtat
ctggacacccctcattatagaggcaggtcataccatgatcggaagtccaaagtggacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaatcactctgtgaac
ctcagggaggagctgaagctgaccaatgcagtcttcttcccacgatgcctcctcgtgcag
cgctgtggtggcaactgtggttgcggaactgtcaactggaagtcctgcacatgcagctca
gggaagacagtgaagaagtatcatgaggtattgaagtttgagcctggacatttcaagaga
aggggcaaagctaagaatatggctcttgttgatatccagctggatcatcatgagcgatgt
gactgtatctgcagctcaagaccacctcgataa

DBGET integrated database retrieval system