KEGG   Mus musculus (mouse): 71791
Entry
71791             CDS       T01002                                 

Symbol
Cpa4, 1110019K20Rik, AV009555
Name
(RefSeq) carboxypeptidase A4
  KO
K08637  carboxypeptidase A4 [EC:3.4.17.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    71791 (Cpa4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.-  
     71791 (Cpa4)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   71791 (Cpa4)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14
Other DBs
NCBI-GeneID: 71791
NCBI-ProteinID: NP_082202
MGI: 1919041
Ensembl: ENSMUSG00000039070
Vega: OTTMUSG00000014388
UniProt: Q6P8K8
Position
6; 6 A3.3
AA seq 420 aa
MKWLLFFGALIGAGICGRDKFFGDQVFRINVRNGDEIRKLTELVNSDHLKLSVWKSPSTF
DRPVDILVPSVSLLPVKSFLKSQGLDYSVTIEDLQALLDNEDEEMQHNEGIERSGDFNYG
AYHPLEAIYHEMDSIATDFPELVSRVKIGETFEKRPMYVLKFSTGGGKKRPAIWLNAGIH
AREWISQATAIWTARKIVTDYKKDPAITSILKKVDIFLLPVANPDGYVYTQSQNRLWRKT
RSRNPGSRCVGADPNRNWNASFAGEGTSDNPCSEVYHGSHPNSEVEVKSVVDFIQKHGNF
KCFIDLHSYSQLLMYPYGYTVKKAPDAEELDDVARNAAQALASLSGTKYRVGPTCTTVYP
ASGSSVDWAYDNGIKYAFTFELRDTGYYGFLLPASQIIPTAEETWLGLKTIMEHVRDHLY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaagtggctactgttctttggggccctgattggggcaggcatctgcggccgagataaa
ttctttggggaccaagtttttaggattaatgtcagaaatggagacgagatcagaaaactg
actgagctagtgaattctgaccacttaaagctcagtgtctggaaatctccctccactttt
gatcggcccgtggatattctcgtcccttctgtcagcttgctcccagtcaagtccttcctg
aagtcccagggtttagactactccgtgacaattgaggacctccaggcccttttagataac
gaagatgaagaaatgcagcacaatgaagggatagagcggagtggtgacttcaactacgga
gcttaccatcccctggaggctatttaccacgagatggacagtattgccacagactttcct
gagctggtgagcagagtgaagattggagagacatttgaaaagcggcccatgtatgttcta
aagttcagcacgggaggaggcaagaagcggccagccatttggttgaatgcaggcatccat
gcccgtgagtggatctcacaggccacagccatctggacagcgaggaagattgtaactgat
tataaaaaggacccggctatcacctccatcttgaagaaagtggatattttcttgttgccc
gtggccaatcctgatggatatgtgtacacgcaaagccagaaccgattatggagaaagacg
cggtcccggaacccaggaagccgctgtgttggagccgatccaaacagaaactggaatgct
agttttgcaggagaggggaccagtgataacccttgctctgaagtgtaccatggctcccac
cccaattctgaagtggaggtgaaatcggtggtggatttcattcaaaagcatgggaacttc
aaatgcttcattgacctgcatagctactcacagctgctgatgtatccctatgggtacaca
gtcaagaaggccccggatgctgaggagctggacgatgtggcgaggaatgcagcccaagcc
ctggcttctctctcgggcactaagtaccgagtgggcccaacttgcaccaccgtctatcca
gctagtgggagcagcgttgactgggcatacgacaatggcatcaagtatgctttcacattt
gagctgagagacactgggtactacggcttcctcttgccagccagccagatcatccccacc
gcggaggagacctggctagggctgaagaccatcatggaacatgttcgggaccacctctac
tag

DBGET integrated database retrieval system